KEGG   Odobenus rosmarus divergens (Pacific walrus): 101366000Help
Entry
101366000         CDS       T05148                                 

Gene name
SEC63
Definition
(RefSeq) translocation protein SEC63 homolog isoform X1
  KO
K09540  translocation protein SEC63
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro03060  Protein export
oro04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:oro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    101366000 (SEC63)
   04141 Protein processing in endoplasmic reticulum
    101366000 (SEC63)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:oro03110]
    101366000 (SEC63)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:oro02044]
    101366000 (SEC63)
Chaperones and folding catalysts [BR:oro03110]
 Heat shock proteins
  HSP40 / DNAJ
   101366000 (SEC63)
Secretion system [BR:oro02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   101366000 (SEC63)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec63 DnaJ
Motif
Other DBs
NCBI-GeneID: 101366000
NCBI-ProteinID: XP_004397961
UniProt: A0A2U3VRR9
LinkDB All DBs
Position
Unknown
AA seq 760 aa AA seqDB search
MAGQQFQYDDSGNTFFYFLTSFVGLIVIPATYYLWPRDQNAEQIRLKNIRKVYGRCMWYR
LRLLKPQPNIIPTVKKIVLLAGWALFLFLAYKVSKTDREYQEYNPYEVLNLDPGATVAEI
KKQYRLLSLKYHPDKGGDEVMFMRIAKAYAALTDEESRKNWEEFGNPDGPQATSFGIALP
AWIVDQKNSILVLLVYGLAFMVILPVVVGSWWYRSIRYSGDQILIRTTQIYTYFVYKTRN
MDMKRLIMVLAGASEFDPQYNKDATSRPTDNILIPQLIREIGSINLKKNEPPLTCPYSLK
ARVLLLSHLARMKIPETLEEDQQFMLKKCPALLQEMVNVICQLIIMARSREEREFRAPTL
ASLENCMKLSQMAVQGLQQFKSPLLQLPHIEEDNLRRVSNHKKYKIKTIQDLVSLKESDR
HNLLHFLEDEKYEEVMAVLGSFPYVTMDIKSQVLDDEDSNNITVGSLVTVLVKLTRQTMA
EVFEKEQSICAAEEQPAEDGQGDTNKNRTKGGWQQKSKGPKKTAKSKKKKPLKKKPTPVP
LPQSKQQKQKQANGVVGSEAAVKEDEEEVSDKGSDSEEEETNRESQSEKDDGSDRDSDRE
QDEKQNKDDEAEWQELQQSIQRKERALLETKSKITHPVYSLYFPEEKQEWWWLYIADRKE
QTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRSDSYMGLDQIKPLKLEVHEAK
PVPENHPQWDTAIEGDEDQEDSEGFEDSFEEEEEEEEDDD
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggcgggacagcagttccagtacgatgacagcgggaacaccttcttctacttcctcacc
tcattcgtggggcttatcgtgatcccggccacatactacctctggccccgagaccagaat
gccgagcaaattcgattaaagaatatcagaaaagtatatggaagatgtatgtggtatcgt
ttacggttattaaaaccccagccaaatattattcctacagtaaagaaaatagttctgctt
gcaggatgggcattgttcttattccttgcatacaaagtttccaaaacagaccgagaatat
caagaatacaatccttatgaagtattaaatttggatcctggggcaacagtagcagaaatt
aagaaacagtatcgtttgctgtcacttaaatatcatccagataaaggaggtgatgaagtt
atgttcatgaggatagcaaaagcttatgcagctttaactgatgaagagtcgcggaaaaat
tgggaagagtttggaaatccagatggccctcaagccacaagctttggaattgccttgcca
gcttggatagtcgaccagaaaaactcaattttggttttacttgtatatggattagcattc
atggttatccttccagttgttgtaggctcttggtggtatcgctcaatacgctatagtgga
gaccagattctaatacgcacaacacagatttatacatatttcgtttataaaacccgaaat
atggatatgaaacgtcttatcatggttttggctggagcctctgaatttgatcctcagtat
aataaagatgccacaagcagaccaacagataatattctaatacctcagctaatcagagaa
attggcagcattaatctaaagaagaatgagcctccacttacctgcccatatagcctgaaa
gccagagttcttttactgtctcatcttgctagaatgaaaattcctgagacccttgaagaa
gatcagcaatttatgttgaaaaaatgccctgccctacttcaagaaatggttaatgtaatc
tgccagctaataataatggcccggagccgtgaagaaagggagtttcgtgctccaactttg
gcatccctagaaaactgcatgaagctttcccagatggctgtgcagggccttcagcagttt
aagtctccccttctgcagctccctcacattgaagaggacaatcttaggagggtttctaat
cataaaaagtacaaaattaagactattcaggatttggtgagtttaaaagaatcagatcgt
cacaatctactgcacttccttgaagatgaaaaatatgaagaggttatggctgtccttggg
agtttcccatatgtgactatggatataaaatcacaggtattggatgatgaagatagcaac
aacatcacagtaggatccctagttacagtgttggttaaattgacaaggcaaacaatggca
gaagtatttgaaaaggaacagtcgatctgtgctgcagaggaacagccagcagaagatggg
cagggtgatactaataagaacaggacaaaaggaggatggcagcagaagagcaaaggaccc
aagaaaactgctaaatcaaaaaaaaagaaacctttaaaaaaaaaacctacacctgtgccc
ttaccacaatcaaagcaacagaaacaaaagcaggcaaatggagttgttgggagtgaagct
gcagtaaaggaagacgaagaagaagtttctgacaaaggcagtgattctgaagaagaagaa
accaatagagaatcccaaagtgaaaaagatgatggtagtgacagagactctgatagagag
caagatgaaaaacaaaacaaagatgatgaagcagagtggcaagaattacaacaaagtata
cagcgaaaggagagagctctcctggaaaccaaatcaaagataacccatcctgtttatagt
ctttactttcctgaggaaaaacaagaatggtggtggctttatattgcagataggaaggaa
cagacgttaatatctatgccgtatcatgtgtgtacactaaaagatacagaagaggtagaa
ctgaagtttcctgcaccaggaaagcctggaaattatcagtatacggtgtttctgagatca
gactcctatatgggtttggatcagatcaaacccttgaagttggaagttcatgaggctaaa
cctgtaccagaaaatcacccacagtgggatacagcaatagaaggggatgaagaccaggaa
gacagtgagggctttgaagatagctttgaggaggaggaagaagaggaggaagatgatgac
taa

DBGET integrated database retrieval system