KEGG   Odobenus rosmarus divergens (Pacific walrus): 101366316
Entry
101366316         CDS       T05148                                 

Gene name
NFKBIE
Definition
(RefSeq) NF-kappa-B inhibitor epsilon
  KO
K05872  NF-kappa-B inhibitor epsilon
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro04662  B cell receptor signaling pathway
oro04722  Neurotrophin signaling pathway
oro04920  Adipocytokine signaling pathway
oro05169  Epstein-Barr virus infection
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    101366316 (NFKBIE)
   04658 Th1 and Th2 cell differentiation
    101366316 (NFKBIE)
   04659 Th17 cell differentiation
    101366316 (NFKBIE)
   04662 B cell receptor signaling pathway
    101366316 (NFKBIE)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101366316 (NFKBIE)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101366316 (NFKBIE)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101366316 (NFKBIE)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101366316 (NFKBIE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oro03000]
    101366316 (NFKBIE)
Transcription factors [BR:oro03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    101366316 (NFKBIE)
SSDB
Motif
Pfam: Ank_2 Ank Ank_3 Ank_4 Ank_5
Other DBs
NCBI-GeneID: 101366316
NCBI-ProteinID: XP_004408191
UniProt: A0A2U3WHG8
LinkDB
Position
Unknown
AA seq 361 aa
MSEARKGPDETDESQYDSGIESLRSLRSLPEPTPTPASGPADGGGPQPWTHPPGTAEEPQ
QEDTDGERADSTYGSSSLTEPLPLLGGTETENPAPRSPLAAAGALSPQQLEALTYISEDG
DTLVHLAVIHEAPAVLLCCLALLPQEVLDIQNNLYQTALHLAVHLDQPGAVRALVLKGAS
RVLQDRHGDTALHVACQRQHLACARCLLEGRPEPGRGPPHTLDLQLQNWQGLACLHIATL
QRNRPLMELLLQNGADIDTQEGTSGKTALHLAVETQERGLVQFLLQAGARVDARMLNGCT
PLHLAAGRGLSSISSTLCEAGADSLLRNVEDETPQDLAEDPFALLPFDDLKISGKPLLCA
D
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgtcggaggcgcggaaggggccggacgagacagatgagagccagtatgactcgggcatc
gagtctctgcgctctctgcgctccctgcccgagcccaccccgaccccagcctctgggccc
gcggatggcggcggcccccagccctggactcatcctccgggaacagccgaggagccacag
caggaagacacagatggggagcgagctgactccacctatggttcctcgtcgctcaccgag
cccctgcccttgttggggggcacggagaccgagaacccagccccacgctcgccgctcgcc
gccgcgggggccctgagccctcagcagctggaagcactcacttacatctccgaagatgga
gacacgcttgtccacctggcggtgattcatgaggccccagctgtgctgctgtgttgtctg
gctttgctgccccaggaggtcctggacattcagaacaacctctaccagacagcactccat
ctggccgtacatctggaccagcccggtgcagttcgggccctggtgctgaagggggccagt
cgggtgctacaggatcgacatggtgacacagccttgcatgtggcctgtcagcgtcagcac
ctggcctgtgcccgctgcctgctggaggggcggccagaaccaggccgaggaccaccccac
accctggacctccagctgcaaaactggcaaggtctggcctgtctccacatcgccaccctg
cagagaaaccggccgctcatggagctgctgcttcagaacggagctgacattgacacgcag
gagggcacaagtggaaagaccgcactgcacctggctgtggagacccaggagcggggtctg
gtgcagttcctgctccaggctggtgcccgggtagacgcccgcatgctcaacgggtgcaca
cccctgcacctcgcggcgggtcggggcctcagcagcatctcatccactctgtgcgaggca
ggcgccgactccctgctgcggaacgtggaggacgagactccccaggacctggctgaggat
ccctttgctcttttgccctttgatgacctgaagatctctgggaagccactgctgtgtgcc
gactga

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101384149
Entry
101384149         CDS       T05148                                 

Gene name
NFKBIA
Definition
(RefSeq) NF-kappa-B inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04024  cAMP signaling pathway
oro04062  Chemokine signaling pathway
oro04064  NF-kappa B signaling pathway
oro04210  Apoptosis
oro04380  Osteoclast differentiation
oro04620  Toll-like receptor signaling pathway
oro04621  NOD-like receptor signaling pathway
oro04622  RIG-I-like receptor signaling pathway
oro04623  Cytosolic DNA-sensing pathway
oro04625  C-type lectin receptor signaling pathway
oro04657  IL-17 signaling pathway
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro04662  B cell receptor signaling pathway
oro04668  TNF signaling pathway
oro04722  Neurotrophin signaling pathway
oro04920  Adipocytokine signaling pathway
oro04926  Relaxin signaling pathway
oro04931  Insulin resistance
oro05132  Salmonella infection
oro05134  Legionellosis
oro05135  Yersinia infection
oro05140  Leishmaniasis
oro05142  Chagas disease
oro05145  Toxoplasmosis
oro05160  Hepatitis C
oro05161  Hepatitis B
oro05162  Measles
oro05163  Human cytomegalovirus infection
oro05164  Influenza A
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05168  Herpes simplex virus 1 infection
oro05169  Epstein-Barr virus infection
oro05170  Human immunodeficiency virus 1 infection
oro05171  Coronavirus disease - COVID-19
oro05200  Pathways in cancer
oro05203  Viral carcinogenesis
oro05215  Prostate cancer
oro05220  Chronic myeloid leukemia
oro05222  Small cell lung cancer
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101384149 (NFKBIA)
   04668 TNF signaling pathway
    101384149 (NFKBIA)
   04024 cAMP signaling pathway
    101384149 (NFKBIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101384149 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101384149 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    101384149 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    101384149 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    101384149 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    101384149 (NFKBIA)
   04660 T cell receptor signaling pathway
    101384149 (NFKBIA)
   04658 Th1 and Th2 cell differentiation
    101384149 (NFKBIA)
   04659 Th17 cell differentiation
    101384149 (NFKBIA)
   04657 IL-17 signaling pathway
    101384149 (NFKBIA)
   04662 B cell receptor signaling pathway
    101384149 (NFKBIA)
   04062 Chemokine signaling pathway
    101384149 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101384149 (NFKBIA)
   04926 Relaxin signaling pathway
    101384149 (NFKBIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101384149 (NFKBIA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101384149 (NFKBIA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101384149 (NFKBIA)
   05203 Viral carcinogenesis
    101384149 (NFKBIA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101384149 (NFKBIA)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    101384149 (NFKBIA)
   05215 Prostate cancer
    101384149 (NFKBIA)
   05222 Small cell lung cancer
    101384149 (NFKBIA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101384149 (NFKBIA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101384149 (NFKBIA)
   05135 Yersinia infection
    101384149 (NFKBIA)
   05134 Legionellosis
    101384149 (NFKBIA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101384149 (NFKBIA)
   05170 Human immunodeficiency virus 1 infection
    101384149 (NFKBIA)
   05161 Hepatitis B
    101384149 (NFKBIA)
   05160 Hepatitis C
    101384149 (NFKBIA)
   05171 Coronavirus disease - COVID-19
    101384149 (NFKBIA)
   05164 Influenza A
    101384149 (NFKBIA)
   05162 Measles
    101384149 (NFKBIA)
   05168 Herpes simplex virus 1 infection
    101384149 (NFKBIA)
   05163 Human cytomegalovirus infection
    101384149 (NFKBIA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101384149 (NFKBIA)
   05169 Epstein-Barr virus infection
    101384149 (NFKBIA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101384149 (NFKBIA)
   05140 Leishmaniasis
    101384149 (NFKBIA)
   05142 Chagas disease
    101384149 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oro03000]
    101384149 (NFKBIA)
   04131 Membrane trafficking [BR:oro04131]
    101384149 (NFKBIA)
Transcription factors [BR:oro03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    101384149 (NFKBIA)
Membrane trafficking [BR:oro04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    101384149 (NFKBIA)
SSDB
Motif
Pfam: Ank Ank_2 Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 101384149
NCBI-ProteinID: XP_004399856
UniProt: A0A2U3VWJ5
LinkDB
Position
Unknown
AA seq 314 aa
MFQPAEHAQDWAMDGPRDALKKERLLDDRHDSGLDSMKDEDYEQLVKELREIRLQPQEAP
RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCRTQHLYSILQATN
YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNSDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQLLPESEDEESYDTESEFTEDEL
PYDDCVLGGQRLTL
NT seq 945 nt   +upstreamnt  +downstreamnt
atgtttcagcccgccgagcacgcccaggactgggccatggacggtccccgggacgcgctc
aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag
gactacgagcagttggtgaaggagctgcgggagatccgcctgcagccgcaggaggcgccg
cgcggcgccgagccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg
gccatcatccatgaagagaaagcactgactatggaagtgatccgccaagtgaagggcgat
ctggccttcctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc
accaaccaaccagaaattgctgaggcacttctggaagctggctgtgatcctgagctccga
gactttcgaggaaatacccccctacaccttgcctgtgagcaaggctgcctggctagtgtg
ggagtcctgactcagacctgcaggacccagcacctctactccatcctccaggccaccaac
tacaatggtcacacgtgtctacacttagcctctatccatggctacttgggcattgtggag
cttttggtgtctttgggtgctgatgtcaatgctcaggagccctgtaatggccgaaccgcc
ctccatcttgcagtggacttgcagaattctgatctcgtgtcactcttgttgaagtgtggg
gctgatgtcaacagagtgacctaccagggctactccccataccagctcacctggggccgc
ccaagcacacggattcagcagcagctgggccagctgaccctcgaaaaccttcagctgctg
ccggagagcgaggatgaggagagctacgacacggagtcagagttcacagaggacgagctg
ccctatgatgactgtgtgcttggaggccagcgcctgacgttatga

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101386560
Entry
101386560         CDS       T05148                                 

Gene name
NFKBIB
Definition
(RefSeq) NF-kappa-B inhibitor beta isoform X2
  KO
K02581  NF-kappa-B inhibitor beta
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04062  Chemokine signaling pathway
oro04621  NOD-like receptor signaling pathway
oro04622  RIG-I-like receptor signaling pathway
oro04623  Cytosolic DNA-sensing pathway
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro04662  B cell receptor signaling pathway
oro04722  Neurotrophin signaling pathway
oro04920  Adipocytokine signaling pathway
oro05140  Leishmaniasis
oro05145  Toxoplasmosis
oro05162  Measles
oro05164  Influenza A
oro05169  Epstein-Barr virus infection
oro05171  Coronavirus disease - COVID-19
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101386560 (NFKBIB)
   04622 RIG-I-like receptor signaling pathway
    101386560 (NFKBIB)
   04623 Cytosolic DNA-sensing pathway
    101386560 (NFKBIB)
   04660 T cell receptor signaling pathway
    101386560 (NFKBIB)
   04658 Th1 and Th2 cell differentiation
    101386560 (NFKBIB)
   04659 Th17 cell differentiation
    101386560 (NFKBIB)
   04662 B cell receptor signaling pathway
    101386560 (NFKBIB)
   04062 Chemokine signaling pathway
    101386560 (NFKBIB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101386560 (NFKBIB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101386560 (NFKBIB)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101386560 (NFKBIB)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101386560 (NFKBIB)
   05164 Influenza A
    101386560 (NFKBIB)
   05162 Measles
    101386560 (NFKBIB)
   05169 Epstein-Barr virus infection
    101386560 (NFKBIB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101386560 (NFKBIB)
   05140 Leishmaniasis
    101386560 (NFKBIB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oro03000]
    101386560 (NFKBIB)
Transcription factors [BR:oro03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    101386560 (NFKBIB)
SSDB
Motif
Pfam: Ank_2 Ank_3 Ank Ank_5 Ank_4
Other DBs
NCBI-GeneID: 101386560
NCBI-ProteinID: XP_004396460
UniProt: A0A2U3VN15
LinkDB
Position
Unknown
AA seq 354 aa
MAGVACLGKAAEADEWCDSGLGSLGPDAAAPGGPGLGAELGPGLSWAPLVFGYVTEDGDT
ALHLAVIHQHEPFLDFLLGFAAGTEYLDLQNDLGQTALHLAAILGEASAVEKLYTAGAGL
HVAERGGHTALHLACRMRAHACARVLLQPRPRCARGAPNTYLAQGPERTSEANHPPVALY
PEADSEKEDEESEEGWKLQLEAENYEGHTPLHVAVIHKDAEMVRLLREAGADLNKPEPTC
GRSPLHLAVEAQAADVLELLLRAGADPAARMYGGRTPLGSATLRPNPILARLLRAHGAPE
PEDEDDRPGPCSSSSDSDSGDEGDEYDDIVVHSGRSQNRLPPTPASKPLPDDPV
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggccggggtcgcgtgcttggggaaagctgcggaggccgacgaatggtgcgacagcggt
ctgggctctttgggtccggacgcagcagcccccggaggaccggggttgggcgccgagctg
ggcccggggctgtcgtgggcgcccctagtcttcggctacgtcactgaggatggggacacg
gcactgcacttggcagtgattcatcagcatgagcccttcctggatttcctcctaggcttc
gcggctggcactgagtacctggacctgcagaatgacctgggccagacagcccttcacctg
gcagccatcctgggggaggcctccgcagtggagaagttgtatacggcgggtgccgggttg
catgtggcagaacgtgggggccacacagcgctgcacctggcctgccgcatgagggcacat
gcctgcgctcgtgtgctactccagccccgtccccggtgcgccaggggagcccccaacacc
tacctcgctcagggccctgagcgcacctctgaggccaaccacccgcctgttgccttgtac
cccgaagccgactcggagaaggaagatgaagagagtgaggagggttggaagctgcagctg
gaggctgagaactatgagggccataccccacttcacgtggccgtcatccacaaagatgca
gagatggtccggctgctccgggaggccggagcagacctcaacaaaccggagcccacgtgt
ggccggagccccctgcacttggcagtggaggcccaagccgctgacgtgctggagctcctc
ctgagggcaggtgccgaccccgccgcccgcatgtacgggggccgcaccccactgggcagc
gccacgctccggcccaaccccatcctcgcccgccttctccgtgcacatggagcccctgag
cctgaggacgaggacgacaggccaggcccctgcagcagcagtagcgacagtgacagcggg
gacgagggcgatgaatacgatgacatcgtggtccacagtggccggagccaaaaccggcta
cctcccaccccagcctcaaaacctctccccgatgaccccgtctga

DBGET integrated database retrieval system