KEGG   Odobenus rosmarus divergens (Pacific walrus): 101366323
Entry
101366323         CDS       T05148                                 

Gene name
CCNE2
Definition
(RefSeq) G1/S-specific cyclin-E2
  KO
K06626  G1/S-specific cyclin-E1
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04110  Cell cycle
oro04114  Oocyte meiosis
oro04115  p53 signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04218  Cellular senescence
oro04934  Cushing syndrome
oro05161  Hepatitis B
oro05162  Measles
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05169  Epstein-Barr virus infection
oro05200  Pathways in cancer
oro05203  Viral carcinogenesis
oro05206  MicroRNAs in cancer
oro05215  Prostate cancer
oro05222  Small cell lung cancer
oro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101366323 (CCNE2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101366323 (CCNE2)
   04114 Oocyte meiosis
    101366323 (CCNE2)
   04115 p53 signaling pathway
    101366323 (CCNE2)
   04218 Cellular senescence
    101366323 (CCNE2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101366323 (CCNE2)
   05206 MicroRNAs in cancer
    101366323 (CCNE2)
   05203 Viral carcinogenesis
    101366323 (CCNE2)
  09162 Cancer: specific types
   05226 Gastric cancer
    101366323 (CCNE2)
   05215 Prostate cancer
    101366323 (CCNE2)
   05222 Small cell lung cancer
    101366323 (CCNE2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101366323 (CCNE2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101366323 (CCNE2)
   05161 Hepatitis B
    101366323 (CCNE2)
   05162 Measles
    101366323 (CCNE2)
   05169 Epstein-Barr virus infection
    101366323 (CCNE2)
   05165 Human papillomavirus infection
    101366323 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:oro03032]
    101366323 (CCNE2)
   03036 Chromosome and associated proteins [BR:oro03036]
    101366323 (CCNE2)
DNA replication proteins [BR:oro03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    101366323 (CCNE2)
Chromosome and associated proteins [BR:oro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    101366323 (CCNE2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 101366323
NCBI-ProteinID: XP_004410997
UniProt: A0A2U3WPC3
LinkDB
Position
Unknown
AA seq 404 aa
MSRRSSRLQAKQQPQPSQTDSPQEAQIIQAKKRKTAQDVKKRKEDVTKKHQYEIRNCWPP
VLSGGISPCIIIETPHKEMGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKDVWLNMLKK
ETRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDI
NKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELCP
VTVISWLNLFLQVDALKDTPKVLLPQYSQEKFIQIAQLLDLCILAIDSLEFQYRILAAAA
LCHFTSIEVVKKASGLEWDSISECVDWMVPFVSVVKSTSPVKLKIFKKISMEDRHNIQTH
TNYLAMLDEVNYVNTFRKEGQLSPVCSGGIMTPPKSTEKPPGKH
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgtcaagacgcagtagccgtttacaagctaagcaacagccccagcccagccagacggat
tccccccaagaagcccagataattcaggccaagaagagaaaaacagctcaggatgtcaaa
aaaaggaaagaggacgtcaccaagaaacatcaatatgagatcaggaattgttggccacct
gtattatctggggggatcagtccttgtattatcattgaaacaccccacaaagaaatggga
acaagtgacttctccagatttacaaattacagatttaaaaatctttttattaatccttca
cctttgcctgatttaagttggggatgttcaaaggatgtttggctaaacatgctaaaaaaa
gagaccagatacgttcatgacaaacattttgaagttctgcattctgacttggaaccacaa
atgaggtcaatacttctagactggcttttagaggtatgtgaagtatacacacttcataga
gaaacattttaccttgcgcaagacttttttgatagatttatgttgacacaaaaggatata
aataaaaatatgcttcaactcattggaattacctcattattcatcgcttccaaacttgag
gaaatatatgctcctaagctccaagaatttgcttatgtcactgatggtgcctgcagtgaa
gaggatattttaagaatggaacttattatattaaaggctttaaaatgggaactctgtcct
gtaacagtcatctcctggctaaatctcttccttcaagttgatgctcttaaagatactcct
aaagttcttctacctcagtattctcaggaaaagttcattcaaatagctcagcttttagat
ctgtgtattctagccatcgattcattagagttccagtacagaatattggctgccgctgcc
ttgtgccattttacctctattgaagtggttaagaaagcctcaggtttggaatgggacagc
atttctgaatgtgtagactggatggtgccttttgtcagcgtagtaaaaagtactagtcct
gtgaagctgaaaatttttaagaagatttctatggaagacagacacaatatccagacacat
acaaattatctggctatgctggatgaagtgaattacgtaaacaccttcagaaaggaggga
cagctgtcaccagtgtgtagtggaggaattatgacaccaccgaagagcactgagaaacca
ccaggaaaacactga

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101382136
Entry
101382136         CDS       T05148                                 

Gene name
CCNE1
Definition
(RefSeq) G1/S-specific cyclin-E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04110  Cell cycle
oro04114  Oocyte meiosis
oro04115  p53 signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04218  Cellular senescence
oro04934  Cushing syndrome
oro05161  Hepatitis B
oro05162  Measles
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05169  Epstein-Barr virus infection
oro05200  Pathways in cancer
oro05203  Viral carcinogenesis
oro05206  MicroRNAs in cancer
oro05215  Prostate cancer
oro05222  Small cell lung cancer
oro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101382136 (CCNE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101382136 (CCNE1)
   04114 Oocyte meiosis
    101382136 (CCNE1)
   04115 p53 signaling pathway
    101382136 (CCNE1)
   04218 Cellular senescence
    101382136 (CCNE1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101382136 (CCNE1)
   05206 MicroRNAs in cancer
    101382136 (CCNE1)
   05203 Viral carcinogenesis
    101382136 (CCNE1)
  09162 Cancer: specific types
   05226 Gastric cancer
    101382136 (CCNE1)
   05215 Prostate cancer
    101382136 (CCNE1)
   05222 Small cell lung cancer
    101382136 (CCNE1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101382136 (CCNE1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101382136 (CCNE1)
   05161 Hepatitis B
    101382136 (CCNE1)
   05162 Measles
    101382136 (CCNE1)
   05169 Epstein-Barr virus infection
    101382136 (CCNE1)
   05165 Human papillomavirus infection
    101382136 (CCNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:oro03032]
    101382136 (CCNE1)
   03036 Chromosome and associated proteins [BR:oro03036]
    101382136 (CCNE1)
DNA replication proteins [BR:oro03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    101382136 (CCNE1)
Chromosome and associated proteins [BR:oro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    101382136 (CCNE1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Connexin50
Other DBs
NCBI-GeneID: 101382136
NCBI-ProteinID: XP_004417642
UniProt: A0A2U3X5G8
LinkDB
Position
Unknown
AA seq 410 aa
MPRERRERDAKERDTMKEESGTDVSVRSRKRKANVAVFLQDPDEEIATLDRTVRSQCSSQ
PWDGNSVCENPCSLIPTPDKEEDEPAYPSSTCGPQSFMPSRASPLPILNWANRDEVWKIM
LNKEKTYLRDKHFMQRHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ
QNIVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGEEILSMELIIMKALKWH
LSPLTIVSWLNVYMQVAYLNDLYEVLLPQYPQQIFIQIAELLDLCVLDVGCLEFPYGVLA
ASALYHFSSSELMQKVSGYQWCDIEKCVKWMVPFAMVIRETGSSKLKHFRGVPAEDAHNI
QTHINSLDLLDKAQAKKAILSEQNRISPLPTGVLTPPQSSKKQSSEQGTA
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgccgagggagaggagggagagggatgcaaaggaacgggacaccatgaaggaggaaagt
ggcacagatgtctctgttcgctccaggaaaaggaaggcaaatgtggctgtttttttgcag
gatccagatgaagaaattgcaacacttgacaggactgtgagaagccagtgcagcagtcag
ccttgggacggtaattctgtgtgtgaaaacccctgctccttgattcccacaccggacaaa
gaagaggatgagccagcatacccaagttccacgtgtggaccgcagagtttcatgccctcc
agagcctcaccactgcctatactgaactgggcaaatagagatgaggtctggaaaattatg
ctaaacaaggaaaagacatacttaagggataagcactttatgcagcggcaccctctcctg
cagcctaagatgcgagcaattcttctggattggttaatggaggtgtgcgaagtctataaa
cttcacagagagacattttacttggcacaggatttctttgatcggtatatggcaacacaa
caaaatattgttaaaacacttttacagcttattgggatttcatctttatttattgctgcc
aaacttgaggaaatctatcctccaaagctacaccagtttgcttatgttacagatggggct
tgttcaggagaggaaattcttagcatggaattaattattatgaaggcccttaagtggcac
ttaagtcccctgaccattgtgtcctggctgaatgtatatatgcaggttgcatatctaaat
gacttatatgaagtgctcctgccacagtatccccagcaaatcttcatacagatcgcagag
cttttagatctttgtgtcctggatgttggctgcttagaatttccctatggtgtacttgct
gcttctgccttgtatcatttctcttcctctgaattgatgcaaaaggtttcagggtatcag
tggtgtgatatagagaagtgtgtcaagtggatggttccatttgccatggttataagggag
actgggagctcaaaacttaagcacttcaggggagttcctgctgaagatgcgcacaacatc
cagacccacataaacagcttggatttgctggacaaagcccaagcaaagaaagccatattg
tctgaacaaaataggatttctcctctccccactggggtcctcactcccccacagagcagt
aagaagcagagcagtgagcaggggaccgcgtga

DBGET integrated database retrieval system