KEGG   Odobenus rosmarus divergens (Pacific walrus): 101367178
Entry
101367178         CDS       T05148                                 

Gene name
IL12A
Definition
(RefSeq) interleukin-12 subunit alpha
  KO
K05406  interleukin 12A
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04060  Cytokine-cytokine receptor interaction
oro04620  Toll-like receptor signaling pathway
oro04622  RIG-I-like receptor signaling pathway
oro04625  C-type lectin receptor signaling pathway
oro04630  JAK-STAT signaling pathway
oro04658  Th1 and Th2 cell differentiation
oro04940  Type I diabetes mellitus
oro05133  Pertussis
oro05134  Legionellosis
oro05140  Leishmaniasis
oro05142  Chagas disease
oro05143  African trypanosomiasis
oro05144  Malaria
oro05145  Toxoplasmosis
oro05146  Amoebiasis
oro05152  Tuberculosis
oro05162  Measles
oro05164  Influenza A
oro05168  Herpes simplex virus 1 infection
oro05171  Coronavirus disease - COVID-19
oro05200  Pathways in cancer
oro05321  Inflammatory bowel disease
oro05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101367178 (IL12A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101367178 (IL12A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101367178 (IL12A)
   04622 RIG-I-like receptor signaling pathway
    101367178 (IL12A)
   04625 C-type lectin receptor signaling pathway
    101367178 (IL12A)
   04658 Th1 and Th2 cell differentiation
    101367178 (IL12A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101367178 (IL12A)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101367178 (IL12A)
   05330 Allograft rejection
    101367178 (IL12A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101367178 (IL12A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101367178 (IL12A)
   05134 Legionellosis
    101367178 (IL12A)
   05152 Tuberculosis
    101367178 (IL12A)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101367178 (IL12A)
   05164 Influenza A
    101367178 (IL12A)
   05162 Measles
    101367178 (IL12A)
   05168 Herpes simplex virus 1 infection
    101367178 (IL12A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101367178 (IL12A)
   05144 Malaria
    101367178 (IL12A)
   05145 Toxoplasmosis
    101367178 (IL12A)
   05140 Leishmaniasis
    101367178 (IL12A)
   05142 Chagas disease
    101367178 (IL12A)
   05143 African trypanosomiasis
    101367178 (IL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oro04052]
    101367178 (IL12A)
   00536 Glycosaminoglycan binding proteins [BR:oro00536]
    101367178 (IL12A)
Cytokines and growth factors [BR:oro04052]
 Cytokines
  Interleukins
   101367178 (IL12A)
Glycosaminoglycan binding proteins [BR:oro00536]
 Heparan sulfate / Heparin
  Cytokines
   101367178 (IL12A)
SSDB
Motif
Pfam: IL12
Other DBs
NCBI-GeneID: 101367178
NCBI-ProteinID: XP_004406122
UniProt: A0A2U3WCB8
LinkDB
Position
Unknown
AA seq 222 aa
MCPPRGLLLVNILVLLNHLDHLSLARSLPTASPSPGMFQCLNHSQNLLKAVSNTLQKARQ
TLELYSCTSEEIDHEDITKDKTSTVEACLPLELTMNESCLASREISLITNGSCLASRKAS
FMTTLCLSSIYEDLKMYQGEFKAMNAKLLMDPKRQIFLDQNMLTAIDELLQALNFNSATV
PQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRMMSYLNSS
NT seq 669 nt   +upstreamnt  +downstreamnt
atgtgcccgccgcgcggcctcctccttgtgaacatcctggtcctcctaaaccacctggac
cacctcagtttggccaggagcctccccacagcctccccaagcccaggaatgttccagtgc
ctcaaccactcccaaaacctgctgaaagccgtcagcaacacgcttcagaaggccagacaa
accctagaactttattcctgcacttccgaagagattgatcatgaagatatcacaaaggat
aaaaccagcacagtggaggcctgcttaccattggaattaaccatgaatgagagttgcctg
gcttccagagagatctctttgataactaatgggagttgcctggcctccagaaaggcatct
tttatgacgaccctgtgccttagcagtatctatgaggacttgaagatgtaccagggagag
ttcaaggccatgaacgcaaagcttttaatggatcctaagaggcagatctttctggatcaa
aacatgctgacagctattgatgagctcttacaggccctgaatttcaacagtgcgactgtg
ccacagaaatcctcccttgaagaaccagatttctataaaactaaaatcaagctctgcata
cttcttcatgctttcagaattcgtgcggtgaccatcgatagaatgatgagctacctgaat
tcttcctaa

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101372789
Entry
101372789         CDS       T05148                                 

Gene name
IL12B
Definition
(RefSeq) interleukin-12 subunit beta isoform X1
  KO
K05425  interleukin 12B
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04060  Cytokine-cytokine receptor interaction
oro04620  Toll-like receptor signaling pathway
oro04622  RIG-I-like receptor signaling pathway
oro04625  C-type lectin receptor signaling pathway
oro04630  JAK-STAT signaling pathway
oro04658  Th1 and Th2 cell differentiation
oro04940  Type I diabetes mellitus
oro05133  Pertussis
oro05134  Legionellosis
oro05140  Leishmaniasis
oro05142  Chagas disease
oro05143  African trypanosomiasis
oro05145  Toxoplasmosis
oro05146  Amoebiasis
oro05152  Tuberculosis
oro05162  Measles
oro05164  Influenza A
oro05168  Herpes simplex virus 1 infection
oro05171  Coronavirus disease - COVID-19
oro05200  Pathways in cancer
oro05205  Proteoglycans in cancer
oro05321  Inflammatory bowel disease
oro05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101372789 (IL12B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101372789 (IL12B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101372789 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    101372789 (IL12B)
   04625 C-type lectin receptor signaling pathway
    101372789 (IL12B)
   04658 Th1 and Th2 cell differentiation
    101372789 (IL12B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101372789 (IL12B)
   05205 Proteoglycans in cancer
    101372789 (IL12B)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101372789 (IL12B)
   05330 Allograft rejection
    101372789 (IL12B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101372789 (IL12B)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101372789 (IL12B)
   05134 Legionellosis
    101372789 (IL12B)
   05152 Tuberculosis
    101372789 (IL12B)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101372789 (IL12B)
   05164 Influenza A
    101372789 (IL12B)
   05162 Measles
    101372789 (IL12B)
   05168 Herpes simplex virus 1 infection
    101372789 (IL12B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101372789 (IL12B)
   05145 Toxoplasmosis
    101372789 (IL12B)
   05140 Leishmaniasis
    101372789 (IL12B)
   05142 Chagas disease
    101372789 (IL12B)
   05143 African trypanosomiasis
    101372789 (IL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oro04052]
    101372789 (IL12B)
   00536 Glycosaminoglycan binding proteins [BR:oro00536]
    101372789 (IL12B)
Cytokines and growth factors [BR:oro04052]
 Cytokines
  Interleukins
   101372789 (IL12B)
Glycosaminoglycan binding proteins [BR:oro00536]
 Heparan sulfate / Heparin
  Cytokines
   101372789 (IL12B)
SSDB
Motif
Pfam: IL12p40_C Ig_3 Ig_5 Ig_2 Ig_4 fn3 I-set ig
Other DBs
NCBI-GeneID: 101372789
NCBI-ProteinID: XP_004404839
UniProt: A0A2U3W964
LinkDB
Position
Unknown
AA seq 329 aa
MHPQQLVVSWFSLVLLASPLMAIWELEKNVYVVELDWHPDAPGETVVLTCHTPEEDDITW
TSDQSSEVLGSGKTLTIQVKEFGDAGRYTCHKGGKVLSHSLLLIHKKEDGIWSTDILKEQ
KESKNKFFLKCEAKNYSGHFTCWWLTAISTDLKFSVKSSRGFSDPQGVTCGAVTLSAERV
RVDNRDYKKYTVGCQEGSTCPAAEESLPIEVVVGAIHKLKYENYTSSFFIRDIIRPDPPM
NLQLKPLQNSRHVEVSWEYPDTWSTPHSYFSLTFCIQGQGKNNREKKERLCVDKTSAKVT
CHKDAKIRVQARDRYYSSFWSDWASVSCS
NT seq 990 nt   +upstreamnt  +downstreamnt
atgcatcctcagcagctggtcgtctcctggttttccctggttttgctggcatctcccctc
atggccatatgggaactggagaaaaatgtttatgttgtagagttggattggcacccggac
gcacccggagaaacggtggtcctcacctgccatacccctgaagaagatgacatcacctgg
acctcggaccagagcagtgaagtcttaggctctggtaaaactctgaccatccaagtcaaa
gaatttggagatgctggccggtatacttgtcataaaggaggcaaggttctgagccattcg
ctcctgctgattcacaaaaaggaagatggaatttggtccactgatatcttaaaggaacag
aaagaatccaaaaataagttctttctaaaatgtgaggcaaagaattattctggacatttc
acctgctggtggctgacggcaatcagtactgacttgaaattcagtgtcaagagcagcaga
ggcttctcggacccccaaggggtgacttgtggagcagtgacactctcagcagagagggtc
cgagtggacaacagggattataagaagtacaccgtggggtgtcaggagggcagcacctgc
cccgcggccgaggagagcctacccatcgaggtcgtggtgggtgccattcacaagctcaag
tatgaaaactacaccagcagcttcttcatcagggacatcatcagaccggacccgcccatg
aacctgcagctgaaaccactacaaaattctcggcatgtggaggtcagctgggaatacccc
gacacctggagcaccccgcattcctacttctccctgacattctgcatacagggccagggc
aagaacaatagggaaaagaaagagagactctgcgtggacaaaacctcagccaaggtcacg
tgccacaaggatgccaagatccgcgtgcaagcccgagaccgctactatagctccttctgg
agtgactgggcatctgtgtcctgcagttag

DBGET integrated database retrieval system