KEGG   Odobenus rosmarus divergens (Pacific walrus): 101367488
Entry
101367488         CDS       T05148                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01522  Endocrine resistance
oro04010  MAPK signaling pathway
oro04012  ErbB signaling pathway
oro04014  Ras signaling pathway
oro04024  cAMP signaling pathway
oro04068  FoxO signaling pathway
oro04071  Sphingolipid signaling pathway
oro04137  Mitophagy - animal
oro04140  Autophagy - animal
oro04141  Protein processing in endoplasmic reticulum
oro04210  Apoptosis
oro04215  Apoptosis - multiple species
oro04217  Necroptosis
oro04310  Wnt signaling pathway
oro04380  Osteoclast differentiation
oro04510  Focal adhesion
oro04530  Tight junction
oro04620  Toll-like receptor signaling pathway
oro04621  NOD-like receptor signaling pathway
oro04622  RIG-I-like receptor signaling pathway
oro04625  C-type lectin receptor signaling pathway
oro04657  IL-17 signaling pathway
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro04664  Fc epsilon RI signaling pathway
oro04668  TNF signaling pathway
oro04722  Neurotrophin signaling pathway
oro04723  Retrograde endocannabinoid signaling
oro04728  Dopaminergic synapse
oro04750  Inflammatory mediator regulation of TRP channels
oro04910  Insulin signaling pathway
oro04912  GnRH signaling pathway
oro04914  Progesterone-mediated oocyte maturation
oro04917  Prolactin signaling pathway
oro04920  Adipocytokine signaling pathway
oro04926  Relaxin signaling pathway
oro04930  Type II diabetes mellitus
oro04931  Insulin resistance
oro04932  Non-alcoholic fatty liver disease
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro04935  Growth hormone synthesis, secretion and action
oro05010  Alzheimer disease
oro05012  Parkinson disease
oro05016  Huntington disease
oro05017  Spinocerebellar ataxia
oro05020  Prion disease
oro05022  Pathways of neurodegeneration - multiple diseases
oro05132  Salmonella infection
oro05133  Pertussis
oro05135  Yersinia infection
oro05142  Chagas disease
oro05145  Toxoplasmosis
oro05152  Tuberculosis
oro05161  Hepatitis B
oro05162  Measles
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05169  Epstein-Barr virus infection
oro05170  Human immunodeficiency virus 1 infection
oro05171  Coronavirus disease - COVID-19
oro05200  Pathways in cancer
oro05210  Colorectal cancer
oro05212  Pancreatic cancer
oro05231  Choline metabolism in cancer
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101367488 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101367488 (MAPK10)
   04012 ErbB signaling pathway
    101367488 (MAPK10)
   04014 Ras signaling pathway
    101367488 (MAPK10)
   04310 Wnt signaling pathway
    101367488 (MAPK10)
   04668 TNF signaling pathway
    101367488 (MAPK10)
   04068 FoxO signaling pathway
    101367488 (MAPK10)
   04071 Sphingolipid signaling pathway
    101367488 (MAPK10)
   04024 cAMP signaling pathway
    101367488 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101367488 (MAPK10)
   04137 Mitophagy - animal
    101367488 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    101367488 (MAPK10)
   04215 Apoptosis - multiple species
    101367488 (MAPK10)
   04217 Necroptosis
    101367488 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101367488 (MAPK10)
   04530 Tight junction
    101367488 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101367488 (MAPK10)
   04621 NOD-like receptor signaling pathway
    101367488 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    101367488 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    101367488 (MAPK10)
   04660 T cell receptor signaling pathway
    101367488 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    101367488 (MAPK10)
   04659 Th17 cell differentiation
    101367488 (MAPK10)
   04657 IL-17 signaling pathway
    101367488 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    101367488 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101367488 (MAPK10)
   04920 Adipocytokine signaling pathway
    101367488 (MAPK10)
   04912 GnRH signaling pathway
    101367488 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    101367488 (MAPK10)
   04917 Prolactin signaling pathway
    101367488 (MAPK10)
   04926 Relaxin signaling pathway
    101367488 (MAPK10)
   04935 Growth hormone synthesis, secretion and action
    101367488 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    101367488 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    101367488 (MAPK10)
   04722 Neurotrophin signaling pathway
    101367488 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101367488 (MAPK10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101367488 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101367488 (MAPK10)
   05231 Choline metabolism in cancer
    101367488 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101367488 (MAPK10)
   05212 Pancreatic cancer
    101367488 (MAPK10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101367488 (MAPK10)
   05012 Parkinson disease
    101367488 (MAPK10)
   05016 Huntington disease
    101367488 (MAPK10)
   05017 Spinocerebellar ataxia
    101367488 (MAPK10)
   05020 Prion disease
    101367488 (MAPK10)
   05022 Pathways of neurodegeneration - multiple diseases
    101367488 (MAPK10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101367488 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101367488 (MAPK10)
   04932 Non-alcoholic fatty liver disease
    101367488 (MAPK10)
   04931 Insulin resistance
    101367488 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101367488 (MAPK10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101367488 (MAPK10)
   05135 Yersinia infection
    101367488 (MAPK10)
   05133 Pertussis
    101367488 (MAPK10)
   05152 Tuberculosis
    101367488 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101367488 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    101367488 (MAPK10)
   05161 Hepatitis B
    101367488 (MAPK10)
   05171 Coronavirus disease - COVID-19
    101367488 (MAPK10)
   05162 Measles
    101367488 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101367488 (MAPK10)
   05169 Epstein-Barr virus infection
    101367488 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101367488 (MAPK10)
   05142 Chagas disease
    101367488 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101367488 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oro01001]
    101367488 (MAPK10)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101367488 (MAPK10)
Protein kinases [BR:oro01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101367488 (MAPK10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 101367488
NCBI-ProteinID: XP_004391605
UniProt: A0A2U3VAX4
LinkDB
Position
Unknown
AA seq 464 aa
MSLHLLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLETSAGPLGCCR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgagcctccatttattgtactactgcagtgaaccaaccttggatgtgaaaattgccttt
tgtcagggattcgataaacaagtggatgtgtcatatattgccaaacattacaacatgagc
aaaagcaaagttgacaaccagttctatagtgtggaagtgggagactcaaccttcacagtt
ctcaagcgctaccagaatttgaagcctattggctctggggctcagggaatagtttgtgct
gcgtatgatgctgttcttgacagaaatgtggccattaagaagctcagcagaccctttcag
aaccaaacgcatgccaagagagcttaccgggagctggtcctcatgaagtgtgtgaaccat
aaaaacattattagtttattaaatgtcttcacaccccagaaaacattggaggaattccaa
gatgtttacttagtaatggaactgatggatgccaacttgtgtcaggtgattcagatggaa
ttagaccatgaacgaatgtcttacctgctataccaaatgttgtgtggcatcaagcacctt
cactctgctggaattattcacagggatttaaaaccaagtaacattgtagtcaagtctgat
tgtacattgaaaatcctcgactttggactagccaggacggcaggcacaagcttcatgatg
actccttacgtggttacacgttattatagagcccccgaggttattctgggaatgggctac
aaggagaatgtggatatatggtctgtgggatgcattatgggagaaatggttcgccacaaa
atcctctttccaggaagggactatattgaccagtggaacaaagtaattgagcaactagga
acaccatgtccggaattcatgaagaaattgcaacctacagtaagaaactatgtggagaat
cggcccaagtatgcaggactcaccttccccaagctctttccagattccctcttcccagcg
gactctgagcacaataaactcaaagccagccaagccagggacttactgtcaaagatgcta
gtgattgacccagcaaaaaggatatccgtggatgacgccttacagcatccttacatcaat
gtgtggtatgaccctgctgaagtggaggcgcctccacctcagatttacgacaaacagttg
gacgaaagagaacacaccattgaagaatggaaagaacttatctacaaagaagtaatgaat
tctgaagaaaagactaaaaacggtgttgtaaaaggacaaccttctccttcaggtgcagca
gtgaacagcagtgagagtctccctccatcttcgtctgtcaatgacatctcctccatgtcc
accgaccagaccctggcatctgacactgacagcagcctggaaacctcagcaggacccctg
ggttgttgcaggtga

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101374143
Entry
101374143         CDS       T05148                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X3
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01522  Endocrine resistance
oro04010  MAPK signaling pathway
oro04012  ErbB signaling pathway
oro04014  Ras signaling pathway
oro04024  cAMP signaling pathway
oro04068  FoxO signaling pathway
oro04071  Sphingolipid signaling pathway
oro04137  Mitophagy - animal
oro04140  Autophagy - animal
oro04141  Protein processing in endoplasmic reticulum
oro04210  Apoptosis
oro04215  Apoptosis - multiple species
oro04217  Necroptosis
oro04310  Wnt signaling pathway
oro04380  Osteoclast differentiation
oro04510  Focal adhesion
oro04530  Tight junction
oro04620  Toll-like receptor signaling pathway
oro04621  NOD-like receptor signaling pathway
oro04622  RIG-I-like receptor signaling pathway
oro04625  C-type lectin receptor signaling pathway
oro04657  IL-17 signaling pathway
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro04664  Fc epsilon RI signaling pathway
oro04668  TNF signaling pathway
oro04722  Neurotrophin signaling pathway
oro04723  Retrograde endocannabinoid signaling
oro04728  Dopaminergic synapse
oro04750  Inflammatory mediator regulation of TRP channels
oro04910  Insulin signaling pathway
oro04912  GnRH signaling pathway
oro04914  Progesterone-mediated oocyte maturation
oro04917  Prolactin signaling pathway
oro04920  Adipocytokine signaling pathway
oro04926  Relaxin signaling pathway
oro04930  Type II diabetes mellitus
oro04931  Insulin resistance
oro04932  Non-alcoholic fatty liver disease
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro04935  Growth hormone synthesis, secretion and action
oro05010  Alzheimer disease
oro05012  Parkinson disease
oro05016  Huntington disease
oro05017  Spinocerebellar ataxia
oro05020  Prion disease
oro05022  Pathways of neurodegeneration - multiple diseases
oro05132  Salmonella infection
oro05133  Pertussis
oro05135  Yersinia infection
oro05142  Chagas disease
oro05145  Toxoplasmosis
oro05152  Tuberculosis
oro05161  Hepatitis B
oro05162  Measles
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05169  Epstein-Barr virus infection
oro05170  Human immunodeficiency virus 1 infection
oro05171  Coronavirus disease - COVID-19
oro05200  Pathways in cancer
oro05210  Colorectal cancer
oro05212  Pancreatic cancer
oro05231  Choline metabolism in cancer
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101374143 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101374143 (MAPK8)
   04012 ErbB signaling pathway
    101374143 (MAPK8)
   04014 Ras signaling pathway
    101374143 (MAPK8)
   04310 Wnt signaling pathway
    101374143 (MAPK8)
   04668 TNF signaling pathway
    101374143 (MAPK8)
   04068 FoxO signaling pathway
    101374143 (MAPK8)
   04071 Sphingolipid signaling pathway
    101374143 (MAPK8)
   04024 cAMP signaling pathway
    101374143 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101374143 (MAPK8)
   04137 Mitophagy - animal
    101374143 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    101374143 (MAPK8)
   04215 Apoptosis - multiple species
    101374143 (MAPK8)
   04217 Necroptosis
    101374143 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101374143 (MAPK8)
   04530 Tight junction
    101374143 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101374143 (MAPK8)
   04621 NOD-like receptor signaling pathway
    101374143 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    101374143 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    101374143 (MAPK8)
   04660 T cell receptor signaling pathway
    101374143 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    101374143 (MAPK8)
   04659 Th17 cell differentiation
    101374143 (MAPK8)
   04657 IL-17 signaling pathway
    101374143 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    101374143 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101374143 (MAPK8)
   04920 Adipocytokine signaling pathway
    101374143 (MAPK8)
   04912 GnRH signaling pathway
    101374143 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    101374143 (MAPK8)
   04917 Prolactin signaling pathway
    101374143 (MAPK8)
   04926 Relaxin signaling pathway
    101374143 (MAPK8)
   04935 Growth hormone synthesis, secretion and action
    101374143 (MAPK8)
  09156 Nervous system
   04728 Dopaminergic synapse
    101374143 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    101374143 (MAPK8)
   04722 Neurotrophin signaling pathway
    101374143 (MAPK8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101374143 (MAPK8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101374143 (MAPK8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101374143 (MAPK8)
   05231 Choline metabolism in cancer
    101374143 (MAPK8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101374143 (MAPK8)
   05212 Pancreatic cancer
    101374143 (MAPK8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101374143 (MAPK8)
   05012 Parkinson disease
    101374143 (MAPK8)
   05016 Huntington disease
    101374143 (MAPK8)
   05017 Spinocerebellar ataxia
    101374143 (MAPK8)
   05020 Prion disease
    101374143 (MAPK8)
   05022 Pathways of neurodegeneration - multiple diseases
    101374143 (MAPK8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101374143 (MAPK8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101374143 (MAPK8)
   04932 Non-alcoholic fatty liver disease
    101374143 (MAPK8)
   04931 Insulin resistance
    101374143 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101374143 (MAPK8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101374143 (MAPK8)
   05135 Yersinia infection
    101374143 (MAPK8)
   05133 Pertussis
    101374143 (MAPK8)
   05152 Tuberculosis
    101374143 (MAPK8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101374143 (MAPK8)
   05170 Human immunodeficiency virus 1 infection
    101374143 (MAPK8)
   05161 Hepatitis B
    101374143 (MAPK8)
   05171 Coronavirus disease - COVID-19
    101374143 (MAPK8)
   05162 Measles
    101374143 (MAPK8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101374143 (MAPK8)
   05169 Epstein-Barr virus infection
    101374143 (MAPK8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101374143 (MAPK8)
   05142 Chagas disease
    101374143 (MAPK8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101374143 (MAPK8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oro01001]
    101374143 (MAPK8)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101374143 (MAPK8)
Protein kinases [BR:oro01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101374143 (MAPK8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 101374143
NCBI-ProteinID: XP_004408643
UniProt: A0A2U3WIK7
LinkDB
Position
Unknown
AA seq 384 aa
MSRSKRDSNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLAQVQQ
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacagcaatttttatagtgtagagattggagattctacgttt
acagtcttgaaacggtatcagaatttaaaacctataggctcaggagctcaaggaatagta
tgtgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctaagccggcca
tttcagaatcagactcatgctaaacgggcttacagagagctagttcttatgaaatgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcgaatctttgccaagtgattcag
atggaactagatcatgaaagaatgtcctaccttctctatcagatgctatgtggaatcaag
caccttcactctgctggaattattcatcgggacctaaagcccagtaatatagtggtaaaa
tcagactgcactttgaagattcttgactttggactggccaggactgcaggaactagtttt
atgatgacaccttacgtagtgactcgctactacagagcacctgaggtcatcctagggatg
ggctacaaagaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag
cttggaacaccatgccctgaattcatgaagaaactacagccaacagtaaggacttatgtt
gaaaacagacctaaatatgctggatatagctttgagaaactcttccccgatgtacttttc
ccagctgactcggaacacaacaaacttaaagccagtcaggcaagggatttgttatccaaa
atgctggtaattgatgcatctaaaagaatctctgtagatgaagctctccagcacccgtat
atcaatgtttggtatgatccttctgaggcagaagctccaccaccaaagatacctgacaag
cagttagatgaaagggaacatacaatagaagaatggaaagagttgatatacaaagaagtt
atggacttggaggagagaaccaagaatggagttataagggggcagccctctcctttagca
caggtgcagcagtga

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101376185
Entry
101376185         CDS       T05148                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9 isoform X2
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01522  Endocrine resistance
oro04010  MAPK signaling pathway
oro04012  ErbB signaling pathway
oro04014  Ras signaling pathway
oro04024  cAMP signaling pathway
oro04068  FoxO signaling pathway
oro04071  Sphingolipid signaling pathway
oro04137  Mitophagy - animal
oro04140  Autophagy - animal
oro04141  Protein processing in endoplasmic reticulum
oro04210  Apoptosis
oro04215  Apoptosis - multiple species
oro04217  Necroptosis
oro04310  Wnt signaling pathway
oro04380  Osteoclast differentiation
oro04510  Focal adhesion
oro04530  Tight junction
oro04620  Toll-like receptor signaling pathway
oro04621  NOD-like receptor signaling pathway
oro04622  RIG-I-like receptor signaling pathway
oro04625  C-type lectin receptor signaling pathway
oro04657  IL-17 signaling pathway
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro04664  Fc epsilon RI signaling pathway
oro04668  TNF signaling pathway
oro04722  Neurotrophin signaling pathway
oro04723  Retrograde endocannabinoid signaling
oro04728  Dopaminergic synapse
oro04750  Inflammatory mediator regulation of TRP channels
oro04910  Insulin signaling pathway
oro04912  GnRH signaling pathway
oro04914  Progesterone-mediated oocyte maturation
oro04917  Prolactin signaling pathway
oro04920  Adipocytokine signaling pathway
oro04926  Relaxin signaling pathway
oro04930  Type II diabetes mellitus
oro04931  Insulin resistance
oro04932  Non-alcoholic fatty liver disease
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro04935  Growth hormone synthesis, secretion and action
oro05010  Alzheimer disease
oro05012  Parkinson disease
oro05016  Huntington disease
oro05017  Spinocerebellar ataxia
oro05020  Prion disease
oro05022  Pathways of neurodegeneration - multiple diseases
oro05132  Salmonella infection
oro05133  Pertussis
oro05135  Yersinia infection
oro05142  Chagas disease
oro05145  Toxoplasmosis
oro05152  Tuberculosis
oro05161  Hepatitis B
oro05162  Measles
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05169  Epstein-Barr virus infection
oro05170  Human immunodeficiency virus 1 infection
oro05171  Coronavirus disease - COVID-19
oro05200  Pathways in cancer
oro05210  Colorectal cancer
oro05212  Pancreatic cancer
oro05231  Choline metabolism in cancer
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101376185 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101376185 (MAPK9)
   04012 ErbB signaling pathway
    101376185 (MAPK9)
   04014 Ras signaling pathway
    101376185 (MAPK9)
   04310 Wnt signaling pathway
    101376185 (MAPK9)
   04668 TNF signaling pathway
    101376185 (MAPK9)
   04068 FoxO signaling pathway
    101376185 (MAPK9)
   04071 Sphingolipid signaling pathway
    101376185 (MAPK9)
   04024 cAMP signaling pathway
    101376185 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101376185 (MAPK9)
   04137 Mitophagy - animal
    101376185 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    101376185 (MAPK9)
   04215 Apoptosis - multiple species
    101376185 (MAPK9)
   04217 Necroptosis
    101376185 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101376185 (MAPK9)
   04530 Tight junction
    101376185 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101376185 (MAPK9)
   04621 NOD-like receptor signaling pathway
    101376185 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    101376185 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    101376185 (MAPK9)
   04660 T cell receptor signaling pathway
    101376185 (MAPK9)
   04658 Th1 and Th2 cell differentiation
    101376185 (MAPK9)
   04659 Th17 cell differentiation
    101376185 (MAPK9)
   04657 IL-17 signaling pathway
    101376185 (MAPK9)
   04664 Fc epsilon RI signaling pathway
    101376185 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101376185 (MAPK9)
   04920 Adipocytokine signaling pathway
    101376185 (MAPK9)
   04912 GnRH signaling pathway
    101376185 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    101376185 (MAPK9)
   04917 Prolactin signaling pathway
    101376185 (MAPK9)
   04926 Relaxin signaling pathway
    101376185 (MAPK9)
   04935 Growth hormone synthesis, secretion and action
    101376185 (MAPK9)
  09156 Nervous system
   04728 Dopaminergic synapse
    101376185 (MAPK9)
   04723 Retrograde endocannabinoid signaling
    101376185 (MAPK9)
   04722 Neurotrophin signaling pathway
    101376185 (MAPK9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101376185 (MAPK9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101376185 (MAPK9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101376185 (MAPK9)
   05231 Choline metabolism in cancer
    101376185 (MAPK9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101376185 (MAPK9)
   05212 Pancreatic cancer
    101376185 (MAPK9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101376185 (MAPK9)
   05012 Parkinson disease
    101376185 (MAPK9)
   05016 Huntington disease
    101376185 (MAPK9)
   05017 Spinocerebellar ataxia
    101376185 (MAPK9)
   05020 Prion disease
    101376185 (MAPK9)
   05022 Pathways of neurodegeneration - multiple diseases
    101376185 (MAPK9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101376185 (MAPK9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101376185 (MAPK9)
   04932 Non-alcoholic fatty liver disease
    101376185 (MAPK9)
   04931 Insulin resistance
    101376185 (MAPK9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101376185 (MAPK9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101376185 (MAPK9)
   05135 Yersinia infection
    101376185 (MAPK9)
   05133 Pertussis
    101376185 (MAPK9)
   05152 Tuberculosis
    101376185 (MAPK9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101376185 (MAPK9)
   05170 Human immunodeficiency virus 1 infection
    101376185 (MAPK9)
   05161 Hepatitis B
    101376185 (MAPK9)
   05171 Coronavirus disease - COVID-19
    101376185 (MAPK9)
   05162 Measles
    101376185 (MAPK9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101376185 (MAPK9)
   05169 Epstein-Barr virus infection
    101376185 (MAPK9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101376185 (MAPK9)
   05142 Chagas disease
    101376185 (MAPK9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101376185 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oro01001]
    101376185 (MAPK9)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101376185 (MAPK9)
Protein kinases [BR:oro01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101376185 (MAPK9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 101376185
NCBI-ProteinID: XP_004412719
UniProt: A0A2U3WTJ7
LinkDB
Position
Unknown
AA seq 424 aa
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSADFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPTEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
LDWEERSKNGVVKDQPSDAAVSSNVTPSRSSSINDISSMSTEQTLASDTDSSLDASTGPL
DGCR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgagtgacagtaaatgtgacagtcagttttacagtgtacaggtggcagactcaaccttc
acggtcctcaaacgataccagcagttgaagccaatcggctctggagcccaaggaattgtt
tgtgccgcttttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct
tttcagaatcaaactcatgcaaagagagcttaccgtgaactcgtcctcttaaaatgtgtc
aatcataaaaatataattagtttgttaaatgtatttacaccacaaaagactctagaagaa
tttcaagatgtgtatttggttatggaattaatggatgctaacttatgtcaggttattcac
atggagttggaccatgaaaggatgtcctaccttctgtaccagatgctctgtggtattaaa
catctgcattcagctggtatcattcatagagacttgaagcctagcaacatcgtagtaaaa
tcagactgcacgcttaagatccttgactttggcctggcccggacagcatgcaccaacttc
atgatgacgccatacgtggtgacgcgctattaccgggcgcccgaagtcatcctgggcatg
ggctacaaagagaacgttgatatctggtcagtgggttgcatcatgggagagctggtgaaa
ggttgtgtgattttccaaggcactgaccatattgatcagtggaataaagtcattgagcag
ctaggaacgccgtctgcggattttatgaagaaacttcagccgactgtgagaaattatgta
gaaaacagaccgaagtaccccggcatcaagtttgaagagctcttcccagattggatattc
ccatcagaatccgaacgagacaaaattaaaacaagtcaagccagagatttgttatcgaaa
atgttagtgatagatcccgacaagcgaatctctgtcgacgaagctttacgtcacccttat
attaccgtttggtacgaccctactgaagccgaggcgccaccacctcagatttatgatgcc
caattggaagaaagagagcatgcaattgaagagtggaaagagctgatttacaaagaagtg
ctggactgggaagagagaagcaagaacggtgtggtcaaagatcagccttcagatgcagca
gtaagcagcaatgtcactccttcccggtcgtcatccatcaacgacatctcatccatgtcc
actgagcagacgctggcctcggacacagacagcagcctcgacgcctcgacgggacccctc
gacggttgccgatga

DBGET integrated database retrieval system