KEGG   Odobenus rosmarus divergens (Pacific walrus): 101367564Help
Entry
101367564         CDS       T05148                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro05164  Influenza A
oro05202  Transcriptional misregulation in cancer
oro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09160 Human Diseases
  09161 Cancers
   05202 Transcriptional misregulation in cancers
    101367564 (TMPRSS2)
   05215 Prostate cancer
    101367564 (TMPRSS2)
  09167 Infectious diseases
   05164 Influenza A
    101367564 (TMPRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:oro01002]
    101367564 (TMPRSS2)
Enzymes [BR:oro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     101367564 (TMPRSS2)
Peptidases [BR:oro01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101367564 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 DUF1986 SRCR Trypsin_2 Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 101367564
NCBI-ProteinID: XP_012419994
UniProt: A0A2U3ZLX1
LinkDB All DBs
Position
Unknown
AA seq 580 aa AA seqDB search
MALNSGSPPGVGPYYENHGYQPESLYPPRPATVPSTYPVYPVPYYPPEGPQSTPRVLTHT
STPAIRMQPKSPSGTACTAKAKKALCIMVSLAAVLAGVAVAAVLLWKFMENKCLVSGVEC
GSSGTCISPSHWCDGVLHCPSGEDENRCVRLYGPNFILQVYSAQRKSWHPVCQDDWNDSY
GRAACQDMGYRNNFYSSQGIVDDSGAVSFMKLNISAGSLDLYQKLYHSDVCSSKMVVSLR
CIECGVTGKIIRQSRIVGGSSASLGDWPWQVSLHVQGTHVCGGSIITPEWIVTAAHCVEE
PLNNPRYWTAFAGILRQSLMFYGHGYRVGKVISHPSYDSGTKNNDIALMKLQTPLTFNDK
VKPVCLPNPGMMLEPDQSCWISGWGATYEKGKTSDELNAVMVPLIEPWRCNSKYVYNNLV
TPAMICAGYLQGSIDSCQGDSGGPLVTLKSRIWWLIGDTSWGSGCAKANRPGVYGNVTVF
TDWIYRQMRVISLSSSSLSTLSLVSKPRSLRGVGCLQEPHQPPTPSTVQTLPPGAPVCSQ
HRPPRPPPSTLTAAQCCPGAKTWGGAFPSPEPTEQGFPVL
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggctttaaactcagggtcaccgccaggagttggaccttactacgaaaaccatggatac
cagcctgaaagcctgtatcccccgcggcccgccacggtccccagcacctacccggtgtat
ccagtcccgtactacccgcccgaggggccccagtccaccccaagggtgctgacgcacacc
tcgacacccgccatccgcatgcagcccaagtccccatcggggacggcgtgcactgcaaag
gccaagaaagcgctgtgcatcatggtctccctggcggctgtcctggcaggagtcgcggtg
gccgccgtcctgctctggaagttcatggagaacaaatgcttggtgtccggggtagagtgc
ggctcctcgggaacctgcatcagcccctcccactggtgcgacggggtcctgcactgcccc
agtggggaggacgagaaccgatgcgttcgcctctacggcccgaacttcatcctccaggtg
tactcagcccagaggaagtcctggcaccccgtgtgtcaggacgactggaatgacagctac
gggagggctgcgtgccaggacatgggctaccggaataatttttattctagccaaggaatt
gtggatgacagtggagccgtcagcttcatgaagctgaacataagcgctggcagtctggac
ctctatcaaaaactgtaccacagtgatgtctgttcttcaaaaatggtggtttctttacgc
tgtatagagtgcggggtcacagggaagatcatccgccagagccggatcgtgggcgggagc
agcgcctccctgggggactggccctggcaggtcagcctgcacgtccagggcacccacgtc
tgcggaggctctatcatcacccccgagtggatcgtgacggccgcccactgtgtggaggaa
ccgctgaacaacccccggtattggacggccttcgcgggaatcctgagacaatctctcatg
ttctatggacatggataccgagtgggaaaagtgatttcccatcccagttatgactccggg
accaagaacaatgacatcgctcttatgaagctgcagacacctctgacttttaacgacaaa
gtgaaaccagtgtgtctgcccaacccaggcatgatgctagagccagatcagtcctgttgg
atttccggatggggggccacctatgagaaagggaagacctcggatgagctgaacgcggtc
atggtgcccctcatcgagccttggcgctgcaacagcaagtacgtctacaacaacctggtc
acgccggccatgatctgcgcaggctatctgcagggaagcatcgactcctgccagggtgac
agcggaggtcccctggtcactttgaagagccgcatctggtggttgattggggacacgagc
tggggatccggctgtgccaaagctaacagaccaggagtgtacggaaatgtgacagtgttt
accgactggatttaccgacaaatgagggtaatttccctgtcctcctcctcactgagcact
ctgagtctggtgtcaaagcccagaagtctgcggggtgtgggctgcctgcaggagccccac
cagccccccacacccagcaccgtgcaaactctgcctcccggggccccagtttgcagtcag
catcgccctccccgtcctccgccgtccaccctcactgctgcccagtgctgcccaggtgca
aagacctggggcggagcctttccgagtccagagccaaccgaacagggcttccctgtgctc
tga

DBGET integrated database retrieval system