KEGG   Odobenus rosmarus divergens (Pacific walrus): 101367969
Entry
101367969         CDS       T05148                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DO alpha chain
  KO
K06752  MHC class II antigen
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04145  Phagosome
oro04514  Cell adhesion molecules
oro04612  Antigen processing and presentation
oro04640  Hematopoietic cell lineage
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04672  Intestinal immune network for IgA production
oro04940  Type I diabetes mellitus
oro05140  Leishmaniasis
oro05145  Toxoplasmosis
oro05150  Staphylococcus aureus infection
oro05152  Tuberculosis
oro05164  Influenza A
oro05166  Human T-cell leukemia virus 1 infection
oro05168  Herpes simplex virus 1 infection
oro05169  Epstein-Barr virus infection
oro05310  Asthma
oro05320  Autoimmune thyroid disease
oro05321  Inflammatory bowel disease
oro05322  Systemic lupus erythematosus
oro05323  Rheumatoid arthritis
oro05330  Allograft rejection
oro05332  Graft-versus-host disease
oro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101367969
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101367969
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101367969
   04612 Antigen processing and presentation
    101367969
   04658 Th1 and Th2 cell differentiation
    101367969
   04659 Th17 cell differentiation
    101367969
   04672 Intestinal immune network for IgA production
    101367969
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101367969
   05322 Systemic lupus erythematosus
    101367969
   05323 Rheumatoid arthritis
    101367969
   05320 Autoimmune thyroid disease
    101367969
   05321 Inflammatory bowel disease
    101367969
   05330 Allograft rejection
    101367969
   05332 Graft-versus-host disease
    101367969
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101367969
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101367969
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101367969
   05152 Tuberculosis
    101367969
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101367969
   05164 Influenza A
    101367969
   05168 Herpes simplex virus 1 infection
    101367969
   05169 Epstein-Barr virus infection
    101367969
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101367969
   05140 Leishmaniasis
    101367969
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101367969
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101367969
  Exosomal proteins of epithelial cells
   101367969
  Exosomal proteins of breast milk
   101367969
SSDB
Motif
Pfam: MHC_II_alpha C1-set Marek_A Ig_3 C2-set_2
Other DBs
NCBI-GeneID: 101367969
NCBI-ProteinID: XP_012420440
UniProt: A0A2U3ZN76
LinkDB
Position
Unknown
AA seq 287 aa
MVLSGGLVLGLHTLMSLLSPHETGAIKADHMGSYGPAFYQSYGASGQFAHEFDGEQLFSV
ELKKREAVWRLPEFGNFAHFDPQNGLASIAVIKAHLDVLVERSNRTRATNVPPRVTVLPK
FRVELGQPNVLICIVDNIFPPVINITWLRNGQIISEGVAQTSFYSQPDHLFRKFCYLTFV
PSADDMYDCKVEHWGLDEPLLKHWEPQVPIPVPDTTETLICAVGLALGLVGFLVGTILII
RGTCLSRAHRYRGPRHLGAGEWVALNRMGWRIILWGALGSGKGDIDK
NT seq 864 nt   +upstreamnt  +downstreamnt
atggtcctcagtggcgggctagtcctgggactccacaccttgatgagcctcctgagcccc
cacgaaactggggccatcaaggctgatcacatgggctcctatggaccagccttctaccaa
tcctatggtgcctcgggtcagtttgcccatgaatttgatggggaacagctgttctctgtg
gaactgaagaagagggaggctgtgtggcgtttgcctgagtttggcaacttcgcccacttt
gacccacagaatggactggccagcatcgcggtgatcaaagcccatctggatgtcttggtg
gaacgctccaaccgcaccagagccaccaacgtgcctccgagagtgactgtactccccaag
tttcgagtggagctgggccagcccaacgtcctcatctgcattgtggacaacatcttccct
cctgtgatcaatatcacctggctgcgcaacggtcaaataatcagcgagggggtggcccag
accagcttctattcccagcctgaccatctgttccgcaagttctgctacctgaccttcgtg
ccctctgcagacgatatgtatgactgcaaggtggagcactggggcctggatgagccactc
ctcaagcactgggagccccaggtgcctatcccagtgccagacaccaccgagactctgatc
tgtgctgtcggcctggctctcggcctggtgggcttccttgtgggcaccatcctcatcatc
agaggcacatgcttgtccagagcccacaggtacagaggccccaggcatctgggggcagga
gagtgggtggctctgaacaggatggggtggaggatcattctttggggagcactggggtca
gggaagggtgacatagacaagtag

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101368848
Entry
101368848         CDS       T05148                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: HLA class II histocompatibility antigen, DP beta 1 chain
  KO
K06752  MHC class II antigen
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04145  Phagosome
oro04514  Cell adhesion molecules
oro04612  Antigen processing and presentation
oro04640  Hematopoietic cell lineage
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04672  Intestinal immune network for IgA production
oro04940  Type I diabetes mellitus
oro05140  Leishmaniasis
oro05145  Toxoplasmosis
oro05150  Staphylococcus aureus infection
oro05152  Tuberculosis
oro05164  Influenza A
oro05166  Human T-cell leukemia virus 1 infection
oro05168  Herpes simplex virus 1 infection
oro05169  Epstein-Barr virus infection
oro05310  Asthma
oro05320  Autoimmune thyroid disease
oro05321  Inflammatory bowel disease
oro05322  Systemic lupus erythematosus
oro05323  Rheumatoid arthritis
oro05330  Allograft rejection
oro05332  Graft-versus-host disease
oro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101368848
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101368848
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101368848
   04612 Antigen processing and presentation
    101368848
   04658 Th1 and Th2 cell differentiation
    101368848
   04659 Th17 cell differentiation
    101368848
   04672 Intestinal immune network for IgA production
    101368848
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101368848
   05322 Systemic lupus erythematosus
    101368848
   05323 Rheumatoid arthritis
    101368848
   05320 Autoimmune thyroid disease
    101368848
   05321 Inflammatory bowel disease
    101368848
   05330 Allograft rejection
    101368848
   05332 Graft-versus-host disease
    101368848
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101368848
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101368848
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101368848
   05152 Tuberculosis
    101368848
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101368848
   05164 Influenza A
    101368848
   05168 Herpes simplex virus 1 infection
    101368848
   05169 Epstein-Barr virus infection
    101368848
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101368848
   05140 Leishmaniasis
    101368848
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101368848
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101368848
  Exosomal proteins of epithelial cells
   101368848
  Exosomal proteins of breast milk
   101368848
SSDB
Motif
Pfam: C1-set MHC_II_beta Ig_3 C2-set_2 Ig_2 ig vMSA
Other DBs
NCBI-GeneID: 101368848
NCBI-ProteinID: XP_012420427
UniProt: A0A2U3ZN59
LinkDB
Position
Unknown
AA seq 253 aa
MVVPRITGVPGMAALMMSLGMLSSPLVQSRDTPELHVYQRRSTCLKFNGTHRFLEQCTYN
RERLVQSDSAVGLFAAVSELGGITAKNWNMQREFLALRRNAVDXLCKHNFDLDEDFTLKR
RLQPQVHVSPSKKGHLQHHNLLVCHVSDFYPGHIQVRWFLNGQEETAGVLSTNSMHNGDW
TFQILVMLEMTPRQGDVYACQVEHPSLDAPVTVEWKAQSDSAWSKMLAGVGGFVLGLIAL
GASFILLCRSQRG
NT seq 762 nt   +upstreamnt  +downstreamnt
atggtggtcccgaggatcactggggtcccagggatggccgctctcatgatgtccttgggg
atgctaagctcccctttggttcagagcagagacaccccagagcttcacgtctaccagagg
cggagtacctgcctcaagttcaacgggacgcaccgcttcctggaacaatgcacctacaac
cgagagcggctcgtccagtccgacagcgccgtggggctgttcgccgccgtgtccgagctg
ggcggcatcacggccaagaactggaacatgcagagggagttcctggctctgagacggaac
gccgtggacntcctgtgcaagcacaacttcgatctggacgaggatttcacgctgaagcgc
cgactccagcctcaagtgcatgtctctccctccaagaaggggcacctgcagcaccacaac
ctgcttgtttgccacgtgtcagatttctacccaggccacattcaagtccgctggttcttg
aatggacaggaggaaacagctggggttttatccaccaactcgatgcataatggagactgg
accttccagatcctggtgatgctggaaatgactccccggcagggagatgtctacgcctgc
caagtggagcaccccagcctagacgctcctgtcaccgtggagtggaaggcacagtctgat
tctgcctggagcaagatgctggctggagtcggaggctttgtgctagggctcatcgccctt
ggagcgagcttcattctcctttgtagaagccagcgaggatga

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101370206
Entry
101370206         CDS       T05148                                 

Definition
(RefSeq) SLA class II histocompatibility antigen, DQ haplotype D alpha chain-like
  KO
K06752  MHC class II antigen
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04145  Phagosome
oro04514  Cell adhesion molecules
oro04612  Antigen processing and presentation
oro04640  Hematopoietic cell lineage
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04672  Intestinal immune network for IgA production
oro04940  Type I diabetes mellitus
oro05140  Leishmaniasis
oro05145  Toxoplasmosis
oro05150  Staphylococcus aureus infection
oro05152  Tuberculosis
oro05164  Influenza A
oro05166  Human T-cell leukemia virus 1 infection
oro05168  Herpes simplex virus 1 infection
oro05169  Epstein-Barr virus infection
oro05310  Asthma
oro05320  Autoimmune thyroid disease
oro05321  Inflammatory bowel disease
oro05322  Systemic lupus erythematosus
oro05323  Rheumatoid arthritis
oro05330  Allograft rejection
oro05332  Graft-versus-host disease
oro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101370206
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101370206
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101370206
   04612 Antigen processing and presentation
    101370206
   04658 Th1 and Th2 cell differentiation
    101370206
   04659 Th17 cell differentiation
    101370206
   04672 Intestinal immune network for IgA production
    101370206
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101370206
   05322 Systemic lupus erythematosus
    101370206
   05323 Rheumatoid arthritis
    101370206
   05320 Autoimmune thyroid disease
    101370206
   05321 Inflammatory bowel disease
    101370206
   05330 Allograft rejection
    101370206
   05332 Graft-versus-host disease
    101370206
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101370206
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101370206
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101370206
   05152 Tuberculosis
    101370206
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101370206
   05164 Influenza A
    101370206
   05168 Herpes simplex virus 1 infection
    101370206
   05169 Epstein-Barr virus infection
    101370206
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101370206
   05140 Leishmaniasis
    101370206
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101370206
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101370206
  Exosomal proteins of epithelial cells
   101370206
  Exosomal proteins of breast milk
   101370206
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A APG12 C2-set_2
Other DBs
NCBI-GeneID: 101370206
NCBI-ProteinID: XP_004417669
UniProt: A0A2U3X5J5
LinkDB
Position
Unknown
AA seq 255 aa
MTLNRVLILGTLTLTTMMSPSGGEDIVADHFASYGINVYQSYGSWGQYTHEFDGDEQFYV
DLEKKETVWQLPVFQTFTSFDPQGALRNLAIAKHNLNILTKRSNSTAATNEVPEVTVFLK
SPAMLGQPNTLICFVDNIFPPVINVTWLKNRRSVTEGVSETSFLAKRDHSFLKISYLTFL
PSADDIYDCKVEHWGLDEPLLKHWEPEIPTPMSELTETVVCALGLTVGLVGIVVGTVFII
QGLRSGGASRHQGPL
NT seq 768 nt   +upstreamnt  +downstreamnt
atgaccctaaatagagttctgattctggggactcttaccctgaccaccatgatgagcccc
tctggtggtgaagacattgtggctgaccactttgcttcctatggcataaatgtctaccag
tcttatggttcctggggccagtacacccatgaatttgatggagatgagcagttctacgtg
gacctggagaagaaggaaactgtctggcagctgcctgtgtttcaaacatttacaagcttt
gacccacagggcgcactgagaaacttggctatagcaaaacacaacttgaacatcctgact
aaacggtccaactccactgctgctaccaatgaggttcctgaggtgactgtgtttctgaag
tctcctgcgatgctgggtcagcccaacaccctcatctgttttgtcgacaacatctttcct
cctgtgatcaatgtcacatggttgaagaataggcgctcagtcacagaaggtgtttctgaa
accagctttctcgccaagagggatcattccttcttaaagatcagttacctcaccttcctc
ccctctgctgatgatatttatgactgcaaggtggagcactggggcctggatgagccactt
ctgaaacactgggaacctgagattccaacccctatgtcagagctgacagagactgtggtc
tgtgccctggggttgactgtgggccttgtgggcatcgtggtgggcactgtcttcattatc
caaggcctgcgctcaggtggtgcttccagacatcaagggcctttgtga

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101370503
Entry
101370503         CDS       T05148                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DQ beta 1 chain-like isoform X1
  KO
K06752  MHC class II antigen
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04145  Phagosome
oro04514  Cell adhesion molecules
oro04612  Antigen processing and presentation
oro04640  Hematopoietic cell lineage
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04672  Intestinal immune network for IgA production
oro04940  Type I diabetes mellitus
oro05140  Leishmaniasis
oro05145  Toxoplasmosis
oro05150  Staphylococcus aureus infection
oro05152  Tuberculosis
oro05164  Influenza A
oro05166  Human T-cell leukemia virus 1 infection
oro05168  Herpes simplex virus 1 infection
oro05169  Epstein-Barr virus infection
oro05310  Asthma
oro05320  Autoimmune thyroid disease
oro05321  Inflammatory bowel disease
oro05322  Systemic lupus erythematosus
oro05323  Rheumatoid arthritis
oro05330  Allograft rejection
oro05332  Graft-versus-host disease
oro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101370503
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101370503
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101370503
   04612 Antigen processing and presentation
    101370503
   04658 Th1 and Th2 cell differentiation
    101370503
   04659 Th17 cell differentiation
    101370503
   04672 Intestinal immune network for IgA production
    101370503
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101370503
   05322 Systemic lupus erythematosus
    101370503
   05323 Rheumatoid arthritis
    101370503
   05320 Autoimmune thyroid disease
    101370503
   05321 Inflammatory bowel disease
    101370503
   05330 Allograft rejection
    101370503
   05332 Graft-versus-host disease
    101370503
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101370503
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101370503
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101370503
   05152 Tuberculosis
    101370503
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101370503
   05164 Influenza A
    101370503
   05168 Herpes simplex virus 1 infection
    101370503
   05169 Epstein-Barr virus infection
    101370503
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101370503
   05140 Leishmaniasis
    101370503
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101370503
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101370503
  Exosomal proteins of epithelial cells
   101370503
  Exosomal proteins of breast milk
   101370503
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Ig_2 C2-set_2 ig MHC_I
Other DBs
NCBI-GeneID: 101370503
NCBI-ProteinID: XP_004417670
UniProt: A0A2U3X5I5
LinkDB
Position
Unknown
AA seq 282 aa
MMPGKMALRIPRGLWTAAEMMILVVLSIPVAEGRDSPQNFVYQFKGECYFTNGTERVRHL
TRYIYNREEYARFDSDVGEYRPVTELGRPDTEYWNSQKDVVEQTRAEVDTVCRHNYGIEE
RTTLQRRVEPTVTISPSRTEVLNHHNLLVCSVTDFYPGQIKVQWFRNDQEETAGVVSTPL
IRNGDWTFQILVMLEITPQRGDVYTCHVEHPSLQSPITVEWRAQSESAQSKMLSGIGGFV
LGLIFLGLGLIIRHRSQKGKALWGNGGEELCLRPSAQGELCL
NT seq 849 nt   +upstreamnt  +downstreamnt
atgatgcctgggaagatggctctgcggatccccagaggcctctggacagcagctgaaatg
atgatcctggtggtgctgagcatcccagtggctgaaggcagagactctccacagaatttc
gtgtaccagtttaagggcgagtgctacttcaccaacgggacggagcgggtgcggcatctg
accagatacatctacaaccgggaggagtacgcgcgcttcgacagcgacgtgggggagtac
cggccggtgacggagctggggcggccggacactgagtactggaacagccagaaggacgtc
gtggagcagacgcgggcggaggtggacacggtgtgcagacacaactatgggattgaggag
agaacgaccttgcagcggcgagtggaacctacagtgaccatctccccgtccaggacagag
gttctgaaccaccacaacctgctggtctgctcagtgacagatttctacccaggccagatc
aaagttcagtggtttcggaatgaccaggaggagacagctggtgtcgtgtccactccactt
attaggaatggggactggaccttccagatcctggtgatgctggaaattactccccagcga
ggagatgtctacacctgccatgtggagcaccccagcctccagagccccatcacagtggag
tggagggcacagtctgaatctgcccagagcaagatgctgagtggcatcggaggctttgtg
ctggggctgatcttcctcgggctgggccttatcatccgtcacaggagccagaaaggtaag
gccctctggggaaatgggggagaagagctgtgcctgaggccctctgctcagggggagctg
tgcctctag

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101370728
Entry
101370728         CDS       T05148                                 

Definition
(RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain-like
  KO
K06752  MHC class II antigen
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04145  Phagosome
oro04514  Cell adhesion molecules
oro04612  Antigen processing and presentation
oro04640  Hematopoietic cell lineage
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04672  Intestinal immune network for IgA production
oro04940  Type I diabetes mellitus
oro05140  Leishmaniasis
oro05145  Toxoplasmosis
oro05150  Staphylococcus aureus infection
oro05152  Tuberculosis
oro05164  Influenza A
oro05166  Human T-cell leukemia virus 1 infection
oro05168  Herpes simplex virus 1 infection
oro05169  Epstein-Barr virus infection
oro05310  Asthma
oro05320  Autoimmune thyroid disease
oro05321  Inflammatory bowel disease
oro05322  Systemic lupus erythematosus
oro05323  Rheumatoid arthritis
oro05330  Allograft rejection
oro05332  Graft-versus-host disease
oro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101370728
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101370728
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101370728
   04612 Antigen processing and presentation
    101370728
   04658 Th1 and Th2 cell differentiation
    101370728
   04659 Th17 cell differentiation
    101370728
   04672 Intestinal immune network for IgA production
    101370728
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101370728
   05322 Systemic lupus erythematosus
    101370728
   05323 Rheumatoid arthritis
    101370728
   05320 Autoimmune thyroid disease
    101370728
   05321 Inflammatory bowel disease
    101370728
   05330 Allograft rejection
    101370728
   05332 Graft-versus-host disease
    101370728
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101370728
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101370728
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101370728
   05152 Tuberculosis
    101370728
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101370728
   05164 Influenza A
    101370728
   05168 Herpes simplex virus 1 infection
    101370728
   05169 Epstein-Barr virus infection
    101370728
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101370728
   05140 Leishmaniasis
    101370728
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101370728
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101370728
  Exosomal proteins of epithelial cells
   101370728
  Exosomal proteins of breast milk
   101370728
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Ig_2 ig C2-set_2 DUF202 I-set MHC_I
Other DBs
NCBI-GeneID: 101370728
NCBI-ProteinID: XP_004407737
UniProt: A0A2U3WGA4
LinkDB
Position
Unknown
AA seq 266 aa
MACLWFPRGLSMAALMVILMMLSSPLAWARDTPPHFLMLCKSECHYSNGTERVRFLDRYF
YNREEFVRFDSDVGEYRPVTELGRPNADYWNSQKDIMEQTRAEVDTDCRHNYGVGESFTV
QRRVEPTVTVYPTKTQPLQHHNLLVCSVNGFYPGHIEVRWFRNGQEEEAGVVSTGLIRNG
DWTFQTLVMLEIVPQSGEVYTCQVEHPSLMSPVTVEWRAQSDSAQSKMLSGIGGFVLGLL
FLVVGLFIYFRNQKGHSGLQPTGLLS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggcatgtctgtggttccctagaggcttatcaatggcagctttaatggtgatactgatg
atgctgagctctcccctggcttgggctagagacaccccacctcatttcttaatgctgtgt
aagtccgagtgtcattattccaacgggacggagcgggtgcggttcctggatcggtatttc
tacaaccgggaggagttcgtgcgcttcgacagcgacgtgggggagtaccggccggtgacg
gagctggggcggccgaacgctgactactggaacagccagaaggacatcatggagcagacg
cgggccgaggtggacacggactgcagacacaactacggggtgggtgagagcttcacggtg
cagcggcgagttgagcctacagtgaccgtgtatcctacgaagacccagcccctgcagcac
cacaacctcctggtctgctctgtgaatggtttctatccaggccacattgaagtcaggtgg
ttccggaatggccaggaagaggaggctggggtcgtgtccacaggcctgatccggaatgga
gactggaccttccagaccctagtgatgctggagatagttcctcagagtggagaggtctac
acctgccaagtggagcacccaagcttgatgagccctgtcaccgtggaatggagggcacag
tctgactctgcacaaagcaagatgctgagcggaataggaggctttgttctgggtctgctc
ttccttgtggtggggctgttcatctacttcaggaatcagaagggccactctggacttcag
ccaacaggactcctgagctga

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101371503
Entry
101371503         CDS       T05148                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DM beta chain
  KO
K06752  MHC class II antigen
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04145  Phagosome
oro04514  Cell adhesion molecules
oro04612  Antigen processing and presentation
oro04640  Hematopoietic cell lineage
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04672  Intestinal immune network for IgA production
oro04940  Type I diabetes mellitus
oro05140  Leishmaniasis
oro05145  Toxoplasmosis
oro05150  Staphylococcus aureus infection
oro05152  Tuberculosis
oro05164  Influenza A
oro05166  Human T-cell leukemia virus 1 infection
oro05168  Herpes simplex virus 1 infection
oro05169  Epstein-Barr virus infection
oro05310  Asthma
oro05320  Autoimmune thyroid disease
oro05321  Inflammatory bowel disease
oro05322  Systemic lupus erythematosus
oro05323  Rheumatoid arthritis
oro05330  Allograft rejection
oro05332  Graft-versus-host disease
oro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101371503
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101371503
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101371503
   04612 Antigen processing and presentation
    101371503
   04658 Th1 and Th2 cell differentiation
    101371503
   04659 Th17 cell differentiation
    101371503
   04672 Intestinal immune network for IgA production
    101371503
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101371503
   05322 Systemic lupus erythematosus
    101371503
   05323 Rheumatoid arthritis
    101371503
   05320 Autoimmune thyroid disease
    101371503
   05321 Inflammatory bowel disease
    101371503
   05330 Allograft rejection
    101371503
   05332 Graft-versus-host disease
    101371503
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101371503
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101371503
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101371503
   05152 Tuberculosis
    101371503
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101371503
   05164 Influenza A
    101371503
   05168 Herpes simplex virus 1 infection
    101371503
   05169 Epstein-Barr virus infection
    101371503
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101371503
   05140 Leishmaniasis
    101371503
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101371503
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101371503
  Exosomal proteins of epithelial cells
   101371503
  Exosomal proteins of breast milk
   101371503
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_2 Ig_3 I-set C2-set_2 ig SPARK
Other DBs
NCBI-GeneID: 101371503
NCBI-ProteinID: XP_004407740
UniProt: A0A2U3WGA8
LinkDB
Position
Unknown
AA seq 263 aa
MTTLLPLLLGLSLGSIVAGGFIAHVESTCLLDDDGTPKDFTYCVSFNKDLLTCWDPEEAK
MAPCEFGALNVLAKYLSEYLNQQESLLQRLSNGLQDCATHTQSFWGSLTHRTRPPTVQVA
KTTPFNTKERVMLACYVWGFYPADVTISWRKNGQPVPPHSSAPKMAQPNGDWTYQTVSYL
AITPSYGDTYTCVVEHIGAPEPVSEDWTHGLSPMQIVKVSVSAVTLGLGFIIFSLGLLSW
RRAGSSGYIFLPGDSYPEGQHVS
NT seq 792 nt   +upstreamnt  +downstreamnt
atgaccacactcctgccattgctgctgggcctcagcctgggctccatcgtagcaggtggc
tttatagcccatgtggaaagcacctgtctgttggatgatgatgggactccaaaggatttc
acatattgtgtctccttcaacaaggatttgctgacgtgctgggatccagaggaggccaaa
atggccccttgtgaatttggcgcactgaatgttttggccaagtacctctcagaatacctc
aaccaacaggaatccctgctccagcgcttgtctaatgggcttcaggactgtgccacacat
acccagtctttctggggatcactgacccaccggacacggccaccaactgtgcaagtagcc
aaaaccactccttttaacacgaaggagcgtgtgatgctggcctgctacgtgtggggcttc
tatccagctgatgtgaccatctcgtggaggaagaacgggcagcctgtccctcctcacagt
agtgcccctaagatggcccagcccaatggagactggacatatcagaccgtctcctattta
gctataaccccctcttatggggacacttacacctgtgtggtggagcacatcggggctcct
gagcccgtctctgaggactggacacatgggctgtccccgatgcagatagtgaaggtttct
gtgtctgcagtgactctgggcctgggcttcatcattttctctcttggtttgctcagctgg
cggagagctggctcgtctggctacatttttctccctggggacagttatccagaaggtcaa
cacgtcagttag

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101371809
Entry
101371809         CDS       T05148                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DO beta chain
  KO
K06752  MHC class II antigen
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04145  Phagosome
oro04514  Cell adhesion molecules
oro04612  Antigen processing and presentation
oro04640  Hematopoietic cell lineage
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04672  Intestinal immune network for IgA production
oro04940  Type I diabetes mellitus
oro05140  Leishmaniasis
oro05145  Toxoplasmosis
oro05150  Staphylococcus aureus infection
oro05152  Tuberculosis
oro05164  Influenza A
oro05166  Human T-cell leukemia virus 1 infection
oro05168  Herpes simplex virus 1 infection
oro05169  Epstein-Barr virus infection
oro05310  Asthma
oro05320  Autoimmune thyroid disease
oro05321  Inflammatory bowel disease
oro05322  Systemic lupus erythematosus
oro05323  Rheumatoid arthritis
oro05330  Allograft rejection
oro05332  Graft-versus-host disease
oro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101371809
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101371809
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101371809
   04612 Antigen processing and presentation
    101371809
   04658 Th1 and Th2 cell differentiation
    101371809
   04659 Th17 cell differentiation
    101371809
   04672 Intestinal immune network for IgA production
    101371809
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101371809
   05322 Systemic lupus erythematosus
    101371809
   05323 Rheumatoid arthritis
    101371809
   05320 Autoimmune thyroid disease
    101371809
   05321 Inflammatory bowel disease
    101371809
   05330 Allograft rejection
    101371809
   05332 Graft-versus-host disease
    101371809
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101371809
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101371809
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101371809
   05152 Tuberculosis
    101371809
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101371809
   05164 Influenza A
    101371809
   05168 Herpes simplex virus 1 infection
    101371809
   05169 Epstein-Barr virus infection
    101371809
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101371809
   05140 Leishmaniasis
    101371809
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101371809
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101371809
  Exosomal proteins of epithelial cells
   101371809
  Exosomal proteins of breast milk
   101371809
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 DUF1538
Other DBs
NCBI-GeneID: 101371809
NCBI-ProteinID: XP_004407741
UniProt: A0A2U3WGC5
LinkDB
Position
Unknown
AA seq 273 aa
MSSGWVPWMVALLVNVIRLDSSMTQVRNSPEDFVIQAKADCYFINGTEKVQFVVRFIFNL
EEYARFDSHVGMFVALTELGKPDAALWNSRPDILERSRASVDALCRHNYKLGAPFTVGRK
VQPEVTVYPERTPSLQHHNLLLCYVTGFYPGDIKIRWFRNGQEESVGVVSAGLIRNGDWT
FQTMVMLEMTSELGDVYTCLVNHPSLLSPVAVEWRVQSAYSWRKMLSGIAAFLLGLIFFL
VGTAICLRAQKGYAETQLSGDEVSSTVPSPQPC
NT seq 822 nt   +upstreamnt  +downstreamnt
atgagttctgggtgggttccatggatggtggctctgctagtgaatgtaatcagactggat
tcctccatgactcaagtcagaaactctccagaagattttgtgattcaagcaaaggctgac
tgttacttcatcaatgggacagagaaggtgcagtttgtggtgagatttatttttaacttg
gaagagtatgcacgtttcgacagccatgtgggaatgtttgtggcattgacagagctgggg
aagcctgacgctgcgctgtggaacagtcggccggatatactggagaggagtagagcttct
gtggatgccctctgcaggcataactacaagctaggtgcacccttcactgtggggagaaaa
gtacaaccagaggtgacagtgtatccagagaggaccccgtccctgcagcaccacaacctg
ctgctctgctatgtgaccggtttctatccaggggacatcaagatcaggtggttccggaat
gggcaggaagagagtgtcggggtcgtgtccgctggccttatcaggaatggagactggacc
ttccagaccatggtgatgctggaaatgacttctgaacttggagatgtctacacctgcctt
gttaatcatcccagcctgctgagccctgttgctgtggagtggagagttcagtctgcatat
tcttggagaaagatgctaagtggaattgcagccttcctgcttgggctgatcttctttctg
gtggggactgccatctgcctcagggctcagaaaggatatgcggagactcagttgtctggt
gatgaggtctcaagcacagttccttcaccacaaccatgctaa

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101372107
Entry
101372107         CDS       T05148                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DM alpha chain
  KO
K06752  MHC class II antigen
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04145  Phagosome
oro04514  Cell adhesion molecules
oro04612  Antigen processing and presentation
oro04640  Hematopoietic cell lineage
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04672  Intestinal immune network for IgA production
oro04940  Type I diabetes mellitus
oro05140  Leishmaniasis
oro05145  Toxoplasmosis
oro05150  Staphylococcus aureus infection
oro05152  Tuberculosis
oro05164  Influenza A
oro05166  Human T-cell leukemia virus 1 infection
oro05168  Herpes simplex virus 1 infection
oro05169  Epstein-Barr virus infection
oro05310  Asthma
oro05320  Autoimmune thyroid disease
oro05321  Inflammatory bowel disease
oro05322  Systemic lupus erythematosus
oro05323  Rheumatoid arthritis
oro05330  Allograft rejection
oro05332  Graft-versus-host disease
oro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101372107
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101372107
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101372107
   04612 Antigen processing and presentation
    101372107
   04658 Th1 and Th2 cell differentiation
    101372107
   04659 Th17 cell differentiation
    101372107
   04672 Intestinal immune network for IgA production
    101372107
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101372107
   05322 Systemic lupus erythematosus
    101372107
   05323 Rheumatoid arthritis
    101372107
   05320 Autoimmune thyroid disease
    101372107
   05321 Inflammatory bowel disease
    101372107
   05330 Allograft rejection
    101372107
   05332 Graft-versus-host disease
    101372107
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101372107
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101372107
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101372107
   05152 Tuberculosis
    101372107
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101372107
   05164 Influenza A
    101372107
   05168 Herpes simplex virus 1 infection
    101372107
   05169 Epstein-Barr virus infection
    101372107
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101372107
   05140 Leishmaniasis
    101372107
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101372107
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101372107
  Exosomal proteins of epithelial cells
   101372107
  Exosomal proteins of breast milk
   101372107
SSDB
Motif
Pfam: MHC_II_alpha C1-set SKG6 FAST_1
Other DBs
NCBI-GeneID: 101372107
NCBI-ProteinID: XP_004407742
UniProt: A0A2U3WGA9
LinkDB
Position
Unknown
AA seq 261 aa
MDHEQTRGAALLRLLNLLWLLPYSRTAPEAPTPAWRDELQNHTFLHTIYCQNWSPSISLS
ETYDGDQLFSFDFSQNTRVPRLPEFADWAQKPGDTSTIFFDKEFCQVMIQKIGPKLEGQI
PVSRGFPIVDMFTLKPLEFGKPNTLVCFVSNLFPPTLTVNWRHHSNPVEGIRPTFVSAVD
ELSFQAFSYLNFTPAPSDLFSCVVTHEIDNYTAVAYWVPHNALPSDLLENVLCGVAFGLG
VLGIIVGLILIMYFRKPCSGD
NT seq 786 nt   +upstreamnt  +downstreamnt
atggatcatgagcagacgcgcggagctgcactgctaaggctgttaaacctcctgtggttg
ctgccctactcccggaccgcccctgaagctcctaccccagcgtggcgggatgaactgcaa
aaccacactttcctgcacacaatatactgccagaactggagtcccagcatcagcctctcg
gaaacctacgatggggaccagcttttctccttcgacttttcccagaacacccgagtgcct
cgcctgcctgaatttgctgactgggctcagaagcctggagatacttccacgattttcttt
gacaaagagttctgccaagttatgatccagaaaataggacccaaactcgaagggcaaatc
cctgtgtctagagggtttcctattgttgacatgttcacgctgaagcccctggagtttggc
aagcccaacaccctggtctgttttgtcagtaatctcttcccacccacgttgacggtgaat
tggcggcatcactccaaccctgtggaaggaatcaggcccacttttgtgtccgcggttgat
gaactcagcttccaggccttttcttacttaaacttcacaccagcaccctctgacctattc
tcctgcgttgtgactcatgagattgacaactacacggcagttgcctattgggtgccccat
aatgcgctgccctctgaccttctggagaatgtgctgtgtggtgtggcctttggcttgggt
gtgctgggcatcattgttggcttaatcctaatcatgtacttccgaaagccttgctcaggt
gattga

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101372409
Entry
101372409         CDS       T05148                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: HLA class II histocompatibility antigen, DP alpha 1 chain
  KO
K06752  MHC class II antigen
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04145  Phagosome
oro04514  Cell adhesion molecules
oro04612  Antigen processing and presentation
oro04640  Hematopoietic cell lineage
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04672  Intestinal immune network for IgA production
oro04940  Type I diabetes mellitus
oro05140  Leishmaniasis
oro05145  Toxoplasmosis
oro05150  Staphylococcus aureus infection
oro05152  Tuberculosis
oro05164  Influenza A
oro05166  Human T-cell leukemia virus 1 infection
oro05168  Herpes simplex virus 1 infection
oro05169  Epstein-Barr virus infection
oro05310  Asthma
oro05320  Autoimmune thyroid disease
oro05321  Inflammatory bowel disease
oro05322  Systemic lupus erythematosus
oro05323  Rheumatoid arthritis
oro05330  Allograft rejection
oro05332  Graft-versus-host disease
oro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101372409
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101372409
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101372409
   04612 Antigen processing and presentation
    101372409
   04658 Th1 and Th2 cell differentiation
    101372409
   04659 Th17 cell differentiation
    101372409
   04672 Intestinal immune network for IgA production
    101372409
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101372409
   05322 Systemic lupus erythematosus
    101372409
   05323 Rheumatoid arthritis
    101372409
   05320 Autoimmune thyroid disease
    101372409
   05321 Inflammatory bowel disease
    101372409
   05330 Allograft rejection
    101372409
   05332 Graft-versus-host disease
    101372409
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101372409
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101372409
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101372409
   05152 Tuberculosis
    101372409
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101372409
   05164 Influenza A
    101372409
   05168 Herpes simplex virus 1 infection
    101372409
   05169 Epstein-Barr virus infection
    101372409
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101372409
   05140 Leishmaniasis
    101372409
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101372409
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101372409
  Exosomal proteins of epithelial cells
   101372409
  Exosomal proteins of breast milk
   101372409
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3
Other DBs
NCBI-GeneID: 101372409
NCBI-ProteinID: XP_012420426
UniProt: A0A2U3ZP89
LinkDB
Position
Unknown
AA seq 357 aa
MHLEDIRSRTQVMILGAIALAALLSPHGTGAVRVGHVSMYAEFVQTHRPSGECIFEFDED
EQFYVDLDKETLWHLPEFIHAFDYDAWRGIADIVVAKKNLNTLIQRSNHTRATNEAPEVT
VLPKEPVELGQPNTLICHVDKFFPPVLNVTWLRNGQMVTEGIAETIFLPSTEFRFHKFHY
LTFLPMAEDVYDCKVEHWGLDQPLLQHWEAQEPIQVPEMKDSVVCVLGLVAGVVRIITGI
IVLKTRRPDHPWVQGLLVPFLPPAPSPASPAHTLSPARVATPPPGLPPTLPAPRPESASR
PASAFFRRGRRPSSVSGVSFPVPAEVRAVPGAEQGSRDCRYPLTRLALPLLPAPAGP
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgcacctggaagacataaggagccggactcaagtcatgatcctgggagccatcgccctg
gctgccctgctgagcccccatggaactggggccgtgagggtgggccacgtgtcaatgtat
gccgagtttgtccagacacacagaccctccggggagtgcatatttgagtttgatgaggat
gagcagttctatgtggacctggataaggagactctctggcatctgccagagtttattcat
gcctttgactatgatgcttggaggggtattgctgacatcgtcgtggcaaagaagaacctg
aataccctgatccaacggtcaaaccacaccagggccacaaatgaggcacctgaggtgact
gtgttacccaaggagcctgtggagctgggacagcccaacaccctcatctgtcatgtggac
aagttcttcccacctgtgctcaatgtcacatggctgcgcaatgggcagatggtcaccgaa
ggtatagctgagaccatcttcctgcccagcacagaattcagattccacaagttccactac
ctaaccttccttcccatggctgaagacgtctatgactgcaaggtggagcactggggcctg
gaccagccgctccttcagcactgggaggcccaggagccaatccaggtgcctgagatgaag
gacagtgtggtctgtgtcctgggcctggtggcaggtgtggtgcgcatcatcactggcatc
attgtcctgaagaccaggcggcccgaccatccctgggtgcaggggctcctcgtccccttt
ctgccccccgccccctcgccggcgagccccgcccacacgctcagcccagcgcgcgtggcc
acgcccccgcccggcctcccgccaactctccccgcccctcggcccgagtccgcttcccga
ccagcgtcggcctttttccggcgtggccgccgccccagctcagtcagcggcgtgtccttc
cccgtccccgcggaagtccgcgcggtcccgggggcggagcagggcagccgcgactgtcgt
tacccgctcactcgcctcgcccttcccttgcttcccgctcccgccggaccttaa

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101379071
Entry
101379071         CDS       T05148                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DR alpha chain
  KO
K06752  MHC class II antigen
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04145  Phagosome
oro04514  Cell adhesion molecules
oro04612  Antigen processing and presentation
oro04640  Hematopoietic cell lineage
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04672  Intestinal immune network for IgA production
oro04940  Type I diabetes mellitus
oro05140  Leishmaniasis
oro05145  Toxoplasmosis
oro05150  Staphylococcus aureus infection
oro05152  Tuberculosis
oro05164  Influenza A
oro05166  Human T-cell leukemia virus 1 infection
oro05168  Herpes simplex virus 1 infection
oro05169  Epstein-Barr virus infection
oro05310  Asthma
oro05320  Autoimmune thyroid disease
oro05321  Inflammatory bowel disease
oro05322  Systemic lupus erythematosus
oro05323  Rheumatoid arthritis
oro05330  Allograft rejection
oro05332  Graft-versus-host disease
oro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101379071
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101379071
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101379071
   04612 Antigen processing and presentation
    101379071
   04658 Th1 and Th2 cell differentiation
    101379071
   04659 Th17 cell differentiation
    101379071
   04672 Intestinal immune network for IgA production
    101379071
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101379071
   05322 Systemic lupus erythematosus
    101379071
   05323 Rheumatoid arthritis
    101379071
   05320 Autoimmune thyroid disease
    101379071
   05321 Inflammatory bowel disease
    101379071
   05330 Allograft rejection
    101379071
   05332 Graft-versus-host disease
    101379071
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101379071
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101379071
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101379071
   05152 Tuberculosis
    101379071
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101379071
   05164 Influenza A
    101379071
   05168 Herpes simplex virus 1 infection
    101379071
   05169 Epstein-Barr virus infection
    101379071
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101379071
   05140 Leishmaniasis
    101379071
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101379071
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101379071
  Exosomal proteins of epithelial cells
   101379071
  Exosomal proteins of breast milk
   101379071
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A Ig_2
Other DBs
NCBI-GeneID: 101379071
NCBI-ProteinID: XP_004410689
UniProt: A0A2U3WNN1
LinkDB
Position
Unknown
AA seq 254 aa
MAISGVPVLGFFIMALLMGPQESWAIKEDHVIIQAEFYLTPDPSGEFMFDFDGDEIFHVD
MEKKETVWRLEEFGRFASFEAQGALANIAVDKANLDIMIKRSNHTPNTNVPPEVTVLSNS
PVELGEPNTLICFIDKFSPPVINVTWLRNGNPVTTGVSETVFLPREDHLFRKFHYLPFLP
SADDVYDCKVEHWGLDKPLLKHWEFEAPTPLPETKENVVCALGLVVGLVGIIVGTIFIIK
GMRKVNAGERRGPL
NT seq 765 nt   +upstreamnt  +downstreamnt
atggccataagtggagtcccagtgctaggatttttcatcatggctttactgatgggtccc
caggaatcatgggctatcaaagaggaccatgtgatcatccaggctgagttctatctgacc
cctgacccatcaggagagttcatgtttgacttcgatggtgatgagattttccacgtggat
atggaaaaaaaggagacagtgtggcggctggaagaatttggacgttttgccagctttgag
gcccagggtgccttggccaacatagctgtggacaaagctaacctggacatcatgataaag
cgctccaaccacaccccgaacaccaatgtacctccagaggtgactgtgctctcaaacagc
cccgtggaactgggagagcccaacaccctcatctgtttcatcgacaagttctccccacca
gtgatcaatgtcacgtggcttcgaaatggaaaccctgtcaccacaggagtgtctgagaca
gtcttcctgcccagggaagaccaccttttccgcaagttccactatctccccttcctgccc
tcagccgacgatgtctatgactgcaaggtggagcactggggtttggacaagcctcttctt
aaacactgggagtttgaagcaccaacgcccctcccagagacaaaagagaatgtggtgtgt
gctctgggcctggttgtgggtctggttggcatcattgtcggaaccatcttcatcatcaag
ggcatgcgcaaggtcaatgctggtgaacgccgagggcctctgtga

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101379947
Entry
101379947         CDS       T05148                                 

Definition
(RefSeq) H-2 class II histocompatibility antigen, E-S beta chain-like
  KO
K06752  MHC class II antigen
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04145  Phagosome
oro04514  Cell adhesion molecules
oro04612  Antigen processing and presentation
oro04640  Hematopoietic cell lineage
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04672  Intestinal immune network for IgA production
oro04940  Type I diabetes mellitus
oro05140  Leishmaniasis
oro05145  Toxoplasmosis
oro05150  Staphylococcus aureus infection
oro05152  Tuberculosis
oro05164  Influenza A
oro05166  Human T-cell leukemia virus 1 infection
oro05168  Herpes simplex virus 1 infection
oro05169  Epstein-Barr virus infection
oro05310  Asthma
oro05320  Autoimmune thyroid disease
oro05321  Inflammatory bowel disease
oro05322  Systemic lupus erythematosus
oro05323  Rheumatoid arthritis
oro05330  Allograft rejection
oro05332  Graft-versus-host disease
oro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101379947
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101379947
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101379947
   04612 Antigen processing and presentation
    101379947
   04658 Th1 and Th2 cell differentiation
    101379947
   04659 Th17 cell differentiation
    101379947
   04672 Intestinal immune network for IgA production
    101379947
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101379947
   05322 Systemic lupus erythematosus
    101379947
   05323 Rheumatoid arthritis
    101379947
   05320 Autoimmune thyroid disease
    101379947
   05321 Inflammatory bowel disease
    101379947
   05330 Allograft rejection
    101379947
   05332 Graft-versus-host disease
    101379947
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101379947
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101379947
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101379947
   05152 Tuberculosis
    101379947
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101379947
   05164 Influenza A
    101379947
   05168 Herpes simplex virus 1 infection
    101379947
   05169 Epstein-Barr virus infection
    101379947
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101379947
   05140 Leishmaniasis
    101379947
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101379947
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101379947
  Exosomal proteins of epithelial cells
   101379947
  Exosomal proteins of breast milk
   101379947
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Ig_2 ig DUF202 C2-set_2 I-set MHC_I
Other DBs
NCBI-GeneID: 101379947
NCBI-ProteinID: XP_004410691
UniProt: A0A2U3WNN3
LinkDB
Position
Unknown
AA seq 271 aa
GETSRGRWWFGGAGGATEGAAVSVFQEPAGDRIVSVPTAHFLILGKAECHYSNGTERVRF
LDRYFYNREEFVRFDSDVGEYRPVTELGRPNADYWNSQKDIMEQTRAEVDTDCRHNYGVG
ESFTVQRRVEPTVTVYPTKTQPLQHHNLLVCSVNGFYPGHIEVRWFRNGQEEEAGVVSTG
LIQNGDWTFQTLVMLEIVPQSGEVYTCQVEHPSLTSPVTVEWRAQSESAQSKMLSGIGGF
VLGLLFLVVGLVIYFRNQKGHSGLQPTGLLS
NT seq 817 nt   +upstreamnt  +downstreamnt
aggagaaacgagccgtgggcgctggtggtttgggggcgcggggggagccaccgagggtgc
cgccgtcagtgtcttccaggagcccgcgggtgaccggatcgtctctgtccccacagctca
tttcttaatcctggggaaggccgagtgtcattattccaacgggacggagcgggtgcggtt
cctggatcggtatttctacaaccgggaggagttcgtgcgcttcgacagcgacgtggggga
gtaccggccggtgacggagctggggcggccgaacgctgactactggaacagccagaagga
catcatggagcagacgcgggccgaggtggacacggactgcagacacaactacggggtggg
tgagagcttcacggtgcagcggcgagttgagcctacagtgaccgtgtatcctacgaagac
ccagcccctgcagcaccacaacctcctggtctgctctgtgaacggtttctatccaggcca
cattgaagtcaggtggtttcggaatggccaggaagaggaggctggggtcgtgtccacagg
cctgatccagaatggagactggaccttccagaccctagtgatgctggagatagttcctca
gagtggagaggtctacacctgccaagtggagcacccaagcctgacaagccctgtcaccgt
ggaatggagggcacagtctgagtctgcgcagagcaagatgctgagtggaatcggaggctt
tgttctgggtctgctcttccttgtggtggggctggtcatctacttcaggaatcagaaggg
acactctggacttcagccaacaggactcctgagctga

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101380246
Entry
101380246         CDS       T05148                                 

Definition
(RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain-like
  KO
K06752  MHC class II antigen
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04145  Phagosome
oro04514  Cell adhesion molecules
oro04612  Antigen processing and presentation
oro04640  Hematopoietic cell lineage
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04672  Intestinal immune network for IgA production
oro04940  Type I diabetes mellitus
oro05140  Leishmaniasis
oro05145  Toxoplasmosis
oro05150  Staphylococcus aureus infection
oro05152  Tuberculosis
oro05164  Influenza A
oro05166  Human T-cell leukemia virus 1 infection
oro05168  Herpes simplex virus 1 infection
oro05169  Epstein-Barr virus infection
oro05310  Asthma
oro05320  Autoimmune thyroid disease
oro05321  Inflammatory bowel disease
oro05322  Systemic lupus erythematosus
oro05323  Rheumatoid arthritis
oro05330  Allograft rejection
oro05332  Graft-versus-host disease
oro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101380246
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101380246
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101380246
   04612 Antigen processing and presentation
    101380246
   04658 Th1 and Th2 cell differentiation
    101380246
   04659 Th17 cell differentiation
    101380246
   04672 Intestinal immune network for IgA production
    101380246
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101380246
   05322 Systemic lupus erythematosus
    101380246
   05323 Rheumatoid arthritis
    101380246
   05320 Autoimmune thyroid disease
    101380246
   05321 Inflammatory bowel disease
    101380246
   05330 Allograft rejection
    101380246
   05332 Graft-versus-host disease
    101380246
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101380246
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101380246
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101380246
   05152 Tuberculosis
    101380246
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101380246
   05164 Influenza A
    101380246
   05168 Herpes simplex virus 1 infection
    101380246
   05169 Epstein-Barr virus infection
    101380246
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101380246
   05140 Leishmaniasis
    101380246
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101380246
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101380246
  Exosomal proteins of epithelial cells
   101380246
  Exosomal proteins of breast milk
   101380246
SSDB
Motif
Pfam: C1-set DUF202 DUF3040
Other DBs
NCBI-GeneID: 101380246
NCBI-ProteinID: XP_012421405
UniProt: A0A2U3ZQX8
LinkDB
Position
Unknown
AA seq 166 aa
MASACLPPPKSHINFRWRCVGHVQILGQGEAGECHTEVRWSWNAQEEEAGVVSTGLIGNG
DWTFQTLVMLETVPQSGEVYTCQVEHPSLTSSVTVEWRVQSESAQSRMLSGIGGFVLGLL
FLMVGLFIYFRNQKLIDLVFLEQVVKVKDTNNGKDFGSDFSSGSLH
NT seq 501 nt   +upstreamnt  +downstreamnt
atggcttcagcctgcctgccacctcccaaatctcatattaactttcgctggcggtgtgta
ggccacgtccagatcctggggcaaggagaggctggggaatgccacactgaagtcaggtgg
tcctggaatgcccaggaagaagaggctggggtcgtgtccacaggtctgatcgggaatgga
gactggaccttccagaccctggtgatgctggagacagttcctcagagtggagaggtctac
acctgccaagtggagcacccaagcttgacgagctctgtcaccgtggaatggagggtacag
tctgagtctgcacagagcaggatgctgagcggaatcggaggctttgttctgggtctgctc
ttccttatggtggggctgttcatctacttcaggaatcagaagttgatagatttggttttt
ctggaacaggtggtaaaggtgaaagacacaaataatgggaaagactttggatccgacttc
tcatcaggcagtttacactga

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101380534
Entry
101380534         CDS       T05148                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DR alpha chain-like
  KO
K06752  MHC class II antigen
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04145  Phagosome
oro04514  Cell adhesion molecules
oro04612  Antigen processing and presentation
oro04640  Hematopoietic cell lineage
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04672  Intestinal immune network for IgA production
oro04940  Type I diabetes mellitus
oro05140  Leishmaniasis
oro05145  Toxoplasmosis
oro05150  Staphylococcus aureus infection
oro05152  Tuberculosis
oro05164  Influenza A
oro05166  Human T-cell leukemia virus 1 infection
oro05168  Herpes simplex virus 1 infection
oro05169  Epstein-Barr virus infection
oro05310  Asthma
oro05320  Autoimmune thyroid disease
oro05321  Inflammatory bowel disease
oro05322  Systemic lupus erythematosus
oro05323  Rheumatoid arthritis
oro05330  Allograft rejection
oro05332  Graft-versus-host disease
oro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101380534
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101380534
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101380534
   04612 Antigen processing and presentation
    101380534
   04658 Th1 and Th2 cell differentiation
    101380534
   04659 Th17 cell differentiation
    101380534
   04672 Intestinal immune network for IgA production
    101380534
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101380534
   05322 Systemic lupus erythematosus
    101380534
   05323 Rheumatoid arthritis
    101380534
   05320 Autoimmune thyroid disease
    101380534
   05321 Inflammatory bowel disease
    101380534
   05330 Allograft rejection
    101380534
   05332 Graft-versus-host disease
    101380534
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101380534
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101380534
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101380534
   05152 Tuberculosis
    101380534
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101380534
   05164 Influenza A
    101380534
   05168 Herpes simplex virus 1 infection
    101380534
   05169 Epstein-Barr virus infection
    101380534
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101380534
   05140 Leishmaniasis
    101380534
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101380534
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101380534
  Exosomal proteins of epithelial cells
   101380534
  Exosomal proteins of breast milk
   101380534
SSDB
Motif
Pfam: C1-set Ig_3 Marek_A Ig_2
Other DBs
NCBI-GeneID: 101380534
NCBI-ProteinID: XP_012421406
UniProt: A0A2U3ZS04
LinkDB
Position
Unknown
AA seq 171 aa
MGIMKKHLNQQRLTMEGNPRMGGEIRQQSMIKIYPKSPVELGEPNTLICFIDKFSPPVIN
VTWLRNGNPVTTGVSETVFLPREDHLFRKFHYLPFLPSADDVYDCKVEHWGLDKPLLKHW
EFEAPTPLPETKENVVCALGLVVGLVGIIVGTIFIIKGMRKVNAGERRGPL
NT seq 516 nt   +upstreamnt  +downstreamnt
atggggatcatgaaaaaacatctaaatcagcagagattaacaatggagggaaatccaaga
atgggtggagaaattaggcagcagtccatgatcaaaatataccctaaatcccccgtggaa
ctgggagagcccaacaccctcatctgtttcatcgacaagttctccccaccagtgatcaat
gtcacgtggcttcgaaatggaaaccctgtcaccacaggagtgtctgagacagtcttcctg
cccagggaagaccaccttttccgcaagttccactatctccccttcctgccctcagccgac
gatgtctatgactgcaaggtggagcactggggtttggacaagcctcttcttaaacactgg
gagtttgaagcaccaacccccctcccagagacaaaagagaatgtggtgtgtgccctgggc
ctggttgtgggtctggttggcatcattgtcggaaccatcttcatcatcaagggcatgcgc
aaggtcaatgctggtgaacgccgagggcctctgtga

DBGET integrated database retrieval system