KEGG   Odobenus rosmarus divergens (Pacific walrus): 101368091
Entry
101368091         CDS       T05148                                 

Gene name
FCER2
Definition
(RefSeq) low affinity immunoglobulin epsilon Fc receptor
  KO
K06468  low affinity immunoglobulin epsilon Fc receptor
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04640  Hematopoietic cell lineage
oro05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:oro00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101368091 (FCER2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101368091 (FCER2)
CD molecules [BR:oro04090]
 Proteins
  101368091 (FCER2)
Lectins [BR:oro04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   DC-SIGN subgroup
    101368091 (FCER2)
SSDB
Motif
Pfam: Lectin_C AIP3 CENP-F_leu_zip PTRF_SDPR UL45 HigB-like_toxin
Other DBs
NCBI-GeneID: 101368091
NCBI-ProteinID: XP_012422003
UniProt: A0A2U3ZSN8
LinkDB
Position
Unknown
AA seq 292 aa
MEEHSYSDPAEFPKFSRRRRCCGQRVQLVLVGLATTLLWAGLLTLLLFWHWDTVQNLKQL
EVTAAQNVSRVAKDLERHNGDQMAQKAQAAQVSQNMEEIQAEQKRMKAQDSELSRSLEGL
RSDLSNLKSLSLNERHTALHSLERLQEEVVKLWIELHTSNGSLCNTCPEKWVNFQRKCYY
FGEGPKRWIQARFACSKLQGRLVSIHSQEEQDFLARHANRKGTWIGLRDLDREGEFIWMD
QGPLNYSNWRPGEPNNGGQGEDCVMMQGSGEWNDAFCRSRLDGWVCDRLATC
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaggagcattcgtactcagacccagcagagttcccaaagttttccagaaggcggcga
tgctgtgggcagagggtgcagctggtgctggtggggctggcgaccaccctgctgtgggcc
gggctgctgaccctgcttctcttctggcactgggacactgtgcagaacctgaaacagcta
gaagtaaccgccgcccagaacgtctctcgggttgccaaggacttggaaagacacaacggg
gaccagatggcccagaaagcccaggctgcccaggtgtcacagaacatggaggaaatccaa
gctgaacagaagagaatgaaagctcaggactctgagctctccaggagcctggaaggactt
cgttcggacctgagcaacctcaagtccctgagcttgaacgagagacacacagccttacat
tcactggaaagactccaggaggaggtggtgaagctgtggatagagctacacacgtccaat
ggctccctgtgtaacacgtgccccgagaagtgggtcaacttccagaggaagtgctactac
ttcggtgagggccccaagaggtggatccaggcccggtttgcctgcagcaaactgcaaggg
cggctggtcagcatccacagccaagaggagcaggacttcctggccagacatgccaacagg
aagggcacctggattggcctccgggacctggacagagagggggagtttatctggatggac
cagggccccctgaactatagcaactggcggccgggggagcccaacaacgggggccagggc
gaggattgcgtgatgatgcagggctccggagagtggaatgatgccttctgccgcagccgg
ctggacggctgggtgtgtgaccggctggccacatgctga

DBGET integrated database retrieval system