KEGG   Odobenus rosmarus divergens (Pacific walrus): 101368122
Entry
101368122         CDS       T05148                                 

Gene name
ATF4
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04010  MAPK signaling pathway
oro04022  cGMP-PKG signaling pathway
oro04137  Mitophagy - animal
oro04141  Protein processing in endoplasmic reticulum
oro04151  PI3K-Akt signaling pathway
oro04210  Apoptosis
oro04211  Longevity regulating pathway
oro04261  Adrenergic signaling in cardiomyocytes
oro04668  TNF signaling pathway
oro04720  Long-term potentiation
oro04722  Neurotrophin signaling pathway
oro04725  Cholinergic synapse
oro04728  Dopaminergic synapse
oro04911  Insulin secretion
oro04912  GnRH signaling pathway
oro04915  Estrogen signaling pathway
oro04918  Thyroid hormone synthesis
oro04922  Glucagon signaling pathway
oro04925  Aldosterone synthesis and secretion
oro04926  Relaxin signaling pathway
oro04927  Cortisol synthesis and secretion
oro04928  Parathyroid hormone synthesis, secretion and action
oro04932  Non-alcoholic fatty liver disease
oro04934  Cushing syndrome
oro04935  Growth hormone synthesis, secretion and action
oro05010  Alzheimer disease
oro05012  Parkinson disease
oro05014  Amyotrophic lateral sclerosis
oro05020  Prion disease
oro05022  Pathways of neurodegeneration - multiple diseases
oro05030  Cocaine addiction
oro05031  Amphetamine addiction
oro05034  Alcoholism
oro05161  Hepatitis B
oro05163  Human cytomegalovirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05203  Viral carcinogenesis
oro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101368122 (ATF4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101368122 (ATF4)
   04668 TNF signaling pathway
    101368122 (ATF4)
   04022 cGMP-PKG signaling pathway
    101368122 (ATF4)
   04151 PI3K-Akt signaling pathway
    101368122 (ATF4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101368122 (ATF4)
  09143 Cell growth and death
   04210 Apoptosis
    101368122 (ATF4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101368122 (ATF4)
   04922 Glucagon signaling pathway
    101368122 (ATF4)
   04912 GnRH signaling pathway
    101368122 (ATF4)
   04915 Estrogen signaling pathway
    101368122 (ATF4)
   04926 Relaxin signaling pathway
    101368122 (ATF4)
   04935 Growth hormone synthesis, secretion and action
    101368122 (ATF4)
   04918 Thyroid hormone synthesis
    101368122 (ATF4)
   04928 Parathyroid hormone synthesis, secretion and action
    101368122 (ATF4)
   04925 Aldosterone synthesis and secretion
    101368122 (ATF4)
   04927 Cortisol synthesis and secretion
    101368122 (ATF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101368122 (ATF4)
  09156 Nervous system
   04725 Cholinergic synapse
    101368122 (ATF4)
   04728 Dopaminergic synapse
    101368122 (ATF4)
   04720 Long-term potentiation
    101368122 (ATF4)
   04722 Neurotrophin signaling pathway
    101368122 (ATF4)
  09149 Aging
   04211 Longevity regulating pathway
    101368122 (ATF4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101368122 (ATF4)
  09162 Cancer: specific types
   05215 Prostate cancer
    101368122 (ATF4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101368122 (ATF4)
   05012 Parkinson disease
    101368122 (ATF4)
   05014 Amyotrophic lateral sclerosis
    101368122 (ATF4)
   05020 Prion disease
    101368122 (ATF4)
   05022 Pathways of neurodegeneration - multiple diseases
    101368122 (ATF4)
  09165 Substance dependence
   05030 Cocaine addiction
    101368122 (ATF4)
   05031 Amphetamine addiction
    101368122 (ATF4)
   05034 Alcoholism
    101368122 (ATF4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101368122 (ATF4)
   04934 Cushing syndrome
    101368122 (ATF4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101368122 (ATF4)
   05161 Hepatitis B
    101368122 (ATF4)
   05163 Human cytomegalovirus infection
    101368122 (ATF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oro03000]
    101368122 (ATF4)
Transcription factors [BR:oro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    101368122 (ATF4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF4407 MCU AAA_13 DUF3450 bZIP_Maf DUF745 Nop53 DUF2968 Laminin_II
Other DBs
NCBI-GeneID: 101368122
NCBI-ProteinID: XP_004397500
UniProt: A0A2U3VQN0
LinkDB
Position
Unknown
AA seq 351 aa
MAEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSE
WLAVDGLVSASDNGKEDAFSGTDWMVEKMDLKEFDFDSLFSIDDLETMPDELLATLDDTC
DLFDPLVQETNKEPPQTVNPIGHLPESLQKTDQIAPFTFLQPLPLSPGALSSTPDHSFSL
ELGSEVDISEGDRKSDSATYSNVVPQCIKEEDAPSDNDSGICMSPESYLGSPQHSPSTSR
GSPNRSLLSPRSLCGSARPKPYDPPGEKTEAKVKVEKLDKKLKKMEQNKTAATRYRQKKR
AEQEALTGECKELEKQNEALKERADSLAKEIQYLKDLIEEVRKAREKKRVP
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggccgagatgagtttcctgagcagcgaggtgttggtgggggacttgatgtcccccttc
gaccagtcgggtttgggggctgaggaaagcctaggtctcttagacgactacctggaggtg
gccaagcacttcaagcctcatgggttctccagcgacaaggctaaggcgggctcctccgaa
tggctggctgtggatgggttggtcagtgcctcagacaacggcaaggaggatgccttctcc
gggacagattggatggtggagaaaatggatctgaaggagtttgattttgattctctgttc
agtatagatgacctggaaaccatgccagatgagcttttggccacgttggatgacacgtgt
gatctctttgaccccctagtccaggagactaataaggagcccccccagactgtgaaccca
attggccatcttccagaaagtttacaaaaaacagaccagattgccccctttaccttcctg
caaccacttcccctctccccaggggccctgtcctccactccagatcattcctttagttta
gagctaggcagtgaagtggatatttctgaaggagatagaaagtcagactctgccacttac
agtaatgtggtccctcagtgcatcaaagaggaggatgccccctcagataatgatagtggc
atctgtatgagtcctgagtcctatctggggtccccccagcacagcccctctacctccagg
ggctctccaaataggagcctgctgtctccacgttccctctgtggttctgcccgccccaaa
ccctatgaccctcctggagagaagacagaagcaaaagtaaaggttgaaaaactagataag
aagctgaaaaaaatggagcagaacaagaccgcagccactcggtaccgccagaagaagagg
gctgagcaggaagcactcactggcgagtgtaaagagctggaaaagcagaatgaggctctg
aaagaaagggcagattctttagccaaggagatccagtatctgaaagatttgatagaagag
gtccgaaaggcgagggagaagaaaagggttccctag

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101374034
Entry
101374034         CDS       T05148                                 

Gene name
ATF2
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-2 isoform X1
  KO
K04450  cyclic AMP-dependent transcription factor ATF-2
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04010  MAPK signaling pathway
oro04022  cGMP-PKG signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04211  Longevity regulating pathway
oro04261  Adrenergic signaling in cardiomyocytes
oro04668  TNF signaling pathway
oro04714  Thermogenesis
oro04728  Dopaminergic synapse
oro04911  Insulin secretion
oro04915  Estrogen signaling pathway
oro04918  Thyroid hormone synthesis
oro04922  Glucagon signaling pathway
oro04925  Aldosterone synthesis and secretion
oro04926  Relaxin signaling pathway
oro04927  Cortisol synthesis and secretion
oro04928  Parathyroid hormone synthesis, secretion and action
oro04934  Cushing syndrome
oro04935  Growth hormone synthesis, secretion and action
oro05020  Prion disease
oro05030  Cocaine addiction
oro05031  Amphetamine addiction
oro05034  Alcoholism
oro05161  Hepatitis B
oro05163  Human cytomegalovirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101374034 (ATF2)
   04668 TNF signaling pathway
    101374034 (ATF2)
   04022 cGMP-PKG signaling pathway
    101374034 (ATF2)
   04151 PI3K-Akt signaling pathway
    101374034 (ATF2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101374034 (ATF2)
   04922 Glucagon signaling pathway
    101374034 (ATF2)
   04915 Estrogen signaling pathway
    101374034 (ATF2)
   04926 Relaxin signaling pathway
    101374034 (ATF2)
   04935 Growth hormone synthesis, secretion and action
    101374034 (ATF2)
   04918 Thyroid hormone synthesis
    101374034 (ATF2)
   04928 Parathyroid hormone synthesis, secretion and action
    101374034 (ATF2)
   04925 Aldosterone synthesis and secretion
    101374034 (ATF2)
   04927 Cortisol synthesis and secretion
    101374034 (ATF2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101374034 (ATF2)
  09156 Nervous system
   04728 Dopaminergic synapse
    101374034 (ATF2)
  09149 Aging
   04211 Longevity regulating pathway
    101374034 (ATF2)
  09159 Environmental adaptation
   04714 Thermogenesis
    101374034 (ATF2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101374034 (ATF2)
  09164 Neurodegenerative disease
   05020 Prion disease
    101374034 (ATF2)
  09165 Substance dependence
   05030 Cocaine addiction
    101374034 (ATF2)
   05031 Amphetamine addiction
    101374034 (ATF2)
   05034 Alcoholism
    101374034 (ATF2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101374034 (ATF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101374034 (ATF2)
   05161 Hepatitis B
    101374034 (ATF2)
   05163 Human cytomegalovirus infection
    101374034 (ATF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oro03000]
    101374034 (ATF2)
Transcription factors [BR:oro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    101374034 (ATF2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf zf-C2H2 Herpes_UL16
Other DBs
NCBI-GeneID: 101374034
NCBI-ProteinID: XP_004409058
UniProt: A0A2U3ZPH3
LinkDB
Position
Unknown
AA seq 505 aa
MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN
DSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIR
SKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSD
SSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNV
HVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKSHGS
GLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQNTSGRRRRAANEDPDEKRRKFLE
RNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV
TAMQKKSGYHTADKDDSSEDLSVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQM
ADQSTEPALSQIAMAPASQSQPSGS
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgaaattcaagttacatgtgaattctgccaggcagtacaaggacctgtggaatatgagt
gatgacaaaccctttctatgcactgcccctggatgtggccagcgttttaccaacgaggat
catttggctgtccataaacataaacatgagatgacactgaaatttggtccagcacgtaat
gacagtgtcattgtggctgatcagaccccaacaccaacaagattcttgaaaaactgtgaa
gaagtgggtttgtttaatgagttggcaagtccatttgagaatgaattcaagaaagcctca
gaagacgacattaaaaaaatgcctctagatttatcccctcttgcaacacccatcataaga
agcaaaattgaggagccctctgttgtagaaacaactcaccaggatagtcctttacctcac
ccagagtctactaccagtgatgaaaaggaggtaccattggcacaaactgcacagcccaca
tcagctattgttcgtccagcatcattacaagttcccaatgtgctgcttacaagttctgac
tcaagtgtgattattcagcaagcagtaccttcaccaacctcaagtactgtaatcacccag
gcaccatcctctaacaggccaattgttcctgtaccaggcccatttcctcttctattgcat
cttcctaatggacagaccatgcctgttgctattcctgcatcaattacgagttctaatgtg
catgttccagctgcagtcccacttgttcgaccagtcaccatggtgcctagtgttccagga
attccaggtccttcctcccctcagccagtacagtcagaagcaaaaatgagattaaaagct
gctttgacccagcaacatcctccagttaccaatggtgatactgtcaaaagtcatggtagc
ggattggttagaactcagtcagaggaatctcgaccacagtcattacaacagccagctaca
tccactacagaaactccggcttctccagctcacacaactccacagacccaaaatacaagt
ggtcgtagaagaagagcagctaatgaagatcctgatgaaaaaaggaggaaatttctagag
cgaaatagagcagcagcttcacgatgccgacaaaaaaggaaagtctgggttcagtcttta
gagaagaaggcagaagacttgagttcattaaatggtcaactgcagagtgaagtcaccctg
ctgagaaatgaagtggcacagctgaaacagcttcttctggctcataaagattgccctgta
accgccatgcagaagaaatctggctatcataccgccgataaagatgatagttcagaagac
ctgtcagtgccaagtagtccacatacggaagctatacagcatagttctgtcagcacatcc
aatggagtcagttcaacctccaaggctgaagctgtggccacgtcagtcctcacgcagatg
gcggaccagagtacagagcctgcgctctcacagatagctatggctcctgcctcccagtca
cagccctcaggaagttga

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101376293
Entry
101376293         CDS       T05148                                 

Gene name
CREB3L3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 3 isoform X2
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04022  cGMP-PKG signaling pathway
oro04024  cAMP signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04152  AMPK signaling pathway
oro04211  Longevity regulating pathway
oro04261  Adrenergic signaling in cardiomyocytes
oro04668  TNF signaling pathway
oro04714  Thermogenesis
oro04725  Cholinergic synapse
oro04728  Dopaminergic synapse
oro04911  Insulin secretion
oro04915  Estrogen signaling pathway
oro04916  Melanogenesis
oro04918  Thyroid hormone synthesis
oro04922  Glucagon signaling pathway
oro04925  Aldosterone synthesis and secretion
oro04926  Relaxin signaling pathway
oro04927  Cortisol synthesis and secretion
oro04928  Parathyroid hormone synthesis, secretion and action
oro04931  Insulin resistance
oro04934  Cushing syndrome
oro04935  Growth hormone synthesis, secretion and action
oro04962  Vasopressin-regulated water reabsorption
oro05016  Huntington disease
oro05020  Prion disease
oro05030  Cocaine addiction
oro05031  Amphetamine addiction
oro05034  Alcoholism
oro05161  Hepatitis B
oro05163  Human cytomegalovirus infection
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05203  Viral carcinogenesis
oro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101376293 (CREB3L3)
   04024 cAMP signaling pathway
    101376293 (CREB3L3)
   04022 cGMP-PKG signaling pathway
    101376293 (CREB3L3)
   04151 PI3K-Akt signaling pathway
    101376293 (CREB3L3)
   04152 AMPK signaling pathway
    101376293 (CREB3L3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101376293 (CREB3L3)
   04922 Glucagon signaling pathway
    101376293 (CREB3L3)
   04915 Estrogen signaling pathway
    101376293 (CREB3L3)
   04926 Relaxin signaling pathway
    101376293 (CREB3L3)
   04935 Growth hormone synthesis, secretion and action
    101376293 (CREB3L3)
   04918 Thyroid hormone synthesis
    101376293 (CREB3L3)
   04928 Parathyroid hormone synthesis, secretion and action
    101376293 (CREB3L3)
   04916 Melanogenesis
    101376293 (CREB3L3)
   04925 Aldosterone synthesis and secretion
    101376293 (CREB3L3)
   04927 Cortisol synthesis and secretion
    101376293 (CREB3L3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101376293 (CREB3L3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101376293 (CREB3L3)
  09156 Nervous system
   04725 Cholinergic synapse
    101376293 (CREB3L3)
   04728 Dopaminergic synapse
    101376293 (CREB3L3)
  09149 Aging
   04211 Longevity regulating pathway
    101376293 (CREB3L3)
  09159 Environmental adaptation
   04714 Thermogenesis
    101376293 (CREB3L3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101376293 (CREB3L3)
  09162 Cancer: specific types
   05215 Prostate cancer
    101376293 (CREB3L3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101376293 (CREB3L3)
   05020 Prion disease
    101376293 (CREB3L3)
  09165 Substance dependence
   05030 Cocaine addiction
    101376293 (CREB3L3)
   05031 Amphetamine addiction
    101376293 (CREB3L3)
   05034 Alcoholism
    101376293 (CREB3L3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101376293 (CREB3L3)
   04934 Cushing syndrome
    101376293 (CREB3L3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101376293 (CREB3L3)
   05161 Hepatitis B
    101376293 (CREB3L3)
   05163 Human cytomegalovirus infection
    101376293 (CREB3L3)
   05165 Human papillomavirus infection
    101376293 (CREB3L3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oro03000]
    101376293 (CREB3L3)
Transcription factors [BR:oro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101376293 (CREB3L3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF1664
Other DBs
NCBI-GeneID: 101376293
NCBI-ProteinID: XP_004395389
UniProt: A0A2U3VKE6
LinkDB
Position
Unknown
AA seq 459 aa
MNGDLAAGKMASSTGPMDPIGSLELLDLLFDQQDGILRHVELGEGWDHAEDQVLPGPDSD
DFLNSILTSGDSVPSSPIWSPAASDSGISEDLPSDLPDTPPRSGAAATPTSCHTMESGEG
LCPSYHPGLPCLASPPGPVAQVLETSVAIDLEMWSPGLCSEEQVELMDQPPSCNLTVKDL
LLSGSGATDLQQHQVAAPHLLRAGAEHCQELVLTEDEKKLLAKEGLTLPTQLPLTKYEER
VLKKIRRKIRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEKQNLSLLEQ
LKKLQAIVVQSTSKSAQTGTCIAVLLLSFALIVLPSISPFVANKAENAGDYAPVRVFSRT
LHNDAASRVAPDDIPGSEGPGPRPEDGTSREGSPGSPTVDWESRGMSALDNLMKGLDNST
LIPDNSTLKLNGATLLGWTGPEPALSSGWVGLEAAGEEL
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgaatggggatttagcagctggaaagatggcttcctccaccggtcccatggaccccatt
ggcagcctggagctcctggatctcctgtttgatcagcaggacggcatcctgagacacgtg
gagctgggtgagggctgggaccacgccgaggaccaggtcctgccaggcccagactctgat
gatttcctaaactccatcctgacttctggagactcggtgcccagctccccgatctggtcc
cctgcagccagtgacagtggcatctctgaagacctgccctctgacctcccggacacccct
ccacgcagtggggcggccgccacccccaccagctgccataccatggagtcaggagagggg
ctctgcccctcctaccatcctggactcccctgccttgccagtcccccgggaccagtggcc
caagtgctggagacctctgtggccatagacctggaaatgtggagcccgggcctgtgttcc
gaggagcaggttgagttgatggaccagcctccatcctgcaacctcacagtgaaagatctt
cttctctccggcagcggggccaccgacctgcaacagcatcaagtggcagccccccacctg
ctgcgcgccggggctgagcactgccaggagctggtgctgacagaggatgagaagaagctt
ctggccaaagaaggcctcactctgcccacccagctgcccctcaccaagtacgaggagcga
gtgctgaaaaaaatccgccggaaaatccggaacaaacagtcggcccaagaaagccggaaa
aagaagaaggaatatattgatggcctggaaactcggatgtcagcctgcactgcccagaac
caggagcttcagaggaaggtcttgcatctcgagaagcagaacctgtccctcttggagcag
ctgaagaaactccaggccattgtggtccagtccaccagcaagtcggcccagacgggcacc
tgcatagcggtcctgctgctctcctttgccctcatcgtcctgccctccattagccctttc
gtcgccaacaaagccgagaacgccggagactacgcacctgttcgagttttctccagaact
ttgcacaacgacgctgcatcccgcgtggcccccgacgacataccaggctccgagggccca
ggaccacggcccgaggatggcacatcccgggaagggtctccaggcagccccacggtggac
tgggaatctcggggcatgtcggctctggacaacttgatgaaggggctggacaactcgact
ctgatcccagacaactccacactgaagctgaacggggccaccctgctgggctggactggg
cctgagccagcactcagctctgggtgggtgggattggaggcagcaggggaggagctgtga

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101381436
Entry
101381436         CDS       T05148                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X2
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04022  cGMP-PKG signaling pathway
oro04141  Protein processing in endoplasmic reticulum
oro04151  PI3K-Akt signaling pathway
oro04211  Longevity regulating pathway
oro04261  Adrenergic signaling in cardiomyocytes
oro04668  TNF signaling pathway
oro04728  Dopaminergic synapse
oro04911  Insulin secretion
oro04915  Estrogen signaling pathway
oro04918  Thyroid hormone synthesis
oro04925  Aldosterone synthesis and secretion
oro04926  Relaxin signaling pathway
oro04927  Cortisol synthesis and secretion
oro04928  Parathyroid hormone synthesis, secretion and action
oro04934  Cushing syndrome
oro04935  Growth hormone synthesis, secretion and action
oro05020  Prion disease
oro05030  Cocaine addiction
oro05031  Amphetamine addiction
oro05034  Alcoholism
oro05161  Hepatitis B
oro05163  Human cytomegalovirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101381436 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101381436 (ATF6B)
   04022 cGMP-PKG signaling pathway
    101381436 (ATF6B)
   04151 PI3K-Akt signaling pathway
    101381436 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101381436 (ATF6B)
   04915 Estrogen signaling pathway
    101381436 (ATF6B)
   04926 Relaxin signaling pathway
    101381436 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    101381436 (ATF6B)
   04918 Thyroid hormone synthesis
    101381436 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    101381436 (ATF6B)
   04925 Aldosterone synthesis and secretion
    101381436 (ATF6B)
   04927 Cortisol synthesis and secretion
    101381436 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101381436 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    101381436 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    101381436 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101381436 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    101381436 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    101381436 (ATF6B)
   05031 Amphetamine addiction
    101381436 (ATF6B)
   05034 Alcoholism
    101381436 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101381436 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101381436 (ATF6B)
   05161 Hepatitis B
    101381436 (ATF6B)
   05163 Human cytomegalovirus infection
    101381436 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oro03000]
    101381436 (ATF6B)
Transcription factors [BR:oro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101381436 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 GIT_CC ZapB YabA Docking
Other DBs
NCBI-GeneID: 101381436
NCBI-ProteinID: XP_004415329
UniProt: A0A2U3X018
LinkDB
Position
Unknown
AA seq 711 aa
MVGGREGKMAELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYTGLDDVAEEQTQLFRCP
EQDVPFGSSSLDVGMDVSPPEPPWDPLPIFPDLQVKSEPSSPCSSSSLSSESSHLSTEPS
SQASGVGEVLVVKTESLAPPLCFLGDDPTSPFETVQINVGPTSDDPSDVQTKVEPVSPSS
SINSEASLLSAESPNQAFIGEEVLEVKTESPSPQGCLLRDVLGPPLGGVQISMGPSSDGS
LGKALPTRKPPLQPKPVVITTVPMPPRAVPPSTTILLQPLVQPPPVSPVVLIQGAIRVQP
EGQAAPAPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQG
LEARLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFG
PVSISEPPSAPVSPRMSGEEPPPRRHLLEFSTQEPVQGVKPLQGSPLGPEEPQPSAPGRP
SFRNLTAFPGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQ
RAPERQKSQLRKKSPPVKAVPTQPPGPPERDSVGQLQLYRHPDRSQPEFLDAIDRREDTF
YVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDT
RVIHIKTSTVPPSLRKQPSSAPGNATGGPLPASAAGQARQTSRRPLYLSHP
NT seq 2136 nt   +upstreamnt  +downstreamnt
atggttggggggcgggagggaaagatggcggaactgatgctcctcagcgagattgcggac
ccaacacgttttttcacggacaacttgctgagcccggaggactggggtctgcagaacagc
actttgtacactggcctggatgatgtggcagaggagcagacgcagctcttccgctgccca
gagcaggatgtcccgtttggcagcagctccctggacgtggggatggatgtcagcccccct
gaaccaccttgggaccccctgcctatattcccagatcttcaggtgaagtctgagccatcc
tccccctgctcctcttcctccctcagctccgaatcatcccatctttccacagaaccctcc
agccaggcctctggtgtaggagaggtgctggttgtgaagacagagtccttggcaccccca
ctctgcttcctaggagatgatccaacatccccatttgaaaccgtccagatcaatgtgggt
cccacctctgatgacccctcagatgtccagaccaaggtagaacctgtctctccatcctcc
tccatcaactcggaggcttccctgctctcagcagagtcccccaaccaggcttttatagga
gaggaggtactggaagtgaagacagagtcaccgtcccctcaggggtgtctcctgcgggat
gtcctaggccccccacttggaggtgtccagatcagcatgggcccatcctccgatggctcc
ttaggcaaagccctacccacccggaagccacccctgcagcccaaacctgtggtgataacc
accgtcccgatgccacccagagctgtgcctcccagcaccaccatccttttgcagcccctt
gtccagccacccccagtctccccagttgtcctcatccaaggtgctattcgggtccagcct
gagggacaagctgccccggctccaaggcctgaaaggaagagcattgttccagctcctatg
cctgggaactcctgcccacctgaagtggatgcaaagctgctgaagcggcagcagcgaatg
atcaagaaccgggagtcggcctgccagtcacggaggaagaagaaagagtatctgcagggc
ctggaggcccggctgcaggccgtgctggccgacaaccagcagctccgccgggagaacgct
gccctccggcggcggctggaggccctgctggctgagaacagtgagctcaagttagggtct
ggaaacaggaaggtggtctgcatcatggtcttccttctcttcattgccttcaactttgga
cctgtcagcatcagtgagcctccttcggctcccgtctctcctcggatgagcggagaggaa
cctccgccccggagacacttgctggagttctcaacgcaagagccagttcagggagttaaa
cccctccagggttcccccctgggccctgaggagccccagcccagtgctccaggccggcca
agtttcaggaacctgacagccttccccgggggtgccaaggagctactgctgagagacctg
gaccagctcttcctctcctctgactgccggcacttcaaccggaccgagtccctgaggctt
gctgatgagctgagcggctgggtccagcgtcaccagagaggccggcggaagatcccccag
agagccccagagagacagaagtctcagctacggaagaagtcgcctccagttaaggcagtc
cccacccaaccccccgggcccccagagagggattctgtgggccagctgcagctgtatcgc
cacccggaccgttcacagccggagttcctggatgcaattgaccgacgagaagacacgttt
tatgttgtgtccttccgaagggaccacttgctgctccccgccatcagccacaacaagacc
tctcggcccaagatgtccctggtgatgcctgccatggctcccaatgagaccctgtcaggc
cggggagccccgggggactatgaggagatgatgcagatcgagtgtgaggtcatggacacc
agggtgattcacatcaagacctccacggtacccccctcgctccgaaaacagccatcctcg
gccccgggcaatgccacaggtggccccttgccagcttctgcagccggccaggcccgccag
acctcccgccggcccctctacctcagtcacccctga

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101381943
Entry
101381943         CDS       T05148                                 

Gene name
CREB3L4
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 4 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04022  cGMP-PKG signaling pathway
oro04024  cAMP signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04152  AMPK signaling pathway
oro04211  Longevity regulating pathway
oro04261  Adrenergic signaling in cardiomyocytes
oro04668  TNF signaling pathway
oro04714  Thermogenesis
oro04725  Cholinergic synapse
oro04728  Dopaminergic synapse
oro04911  Insulin secretion
oro04915  Estrogen signaling pathway
oro04916  Melanogenesis
oro04918  Thyroid hormone synthesis
oro04922  Glucagon signaling pathway
oro04925  Aldosterone synthesis and secretion
oro04926  Relaxin signaling pathway
oro04927  Cortisol synthesis and secretion
oro04928  Parathyroid hormone synthesis, secretion and action
oro04931  Insulin resistance
oro04934  Cushing syndrome
oro04935  Growth hormone synthesis, secretion and action
oro04962  Vasopressin-regulated water reabsorption
oro05016  Huntington disease
oro05020  Prion disease
oro05030  Cocaine addiction
oro05031  Amphetamine addiction
oro05034  Alcoholism
oro05161  Hepatitis B
oro05163  Human cytomegalovirus infection
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05203  Viral carcinogenesis
oro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101381943 (CREB3L4)
   04024 cAMP signaling pathway
    101381943 (CREB3L4)
   04022 cGMP-PKG signaling pathway
    101381943 (CREB3L4)
   04151 PI3K-Akt signaling pathway
    101381943 (CREB3L4)
   04152 AMPK signaling pathway
    101381943 (CREB3L4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101381943 (CREB3L4)
   04922 Glucagon signaling pathway
    101381943 (CREB3L4)
   04915 Estrogen signaling pathway
    101381943 (CREB3L4)
   04926 Relaxin signaling pathway
    101381943 (CREB3L4)
   04935 Growth hormone synthesis, secretion and action
    101381943 (CREB3L4)
   04918 Thyroid hormone synthesis
    101381943 (CREB3L4)
   04928 Parathyroid hormone synthesis, secretion and action
    101381943 (CREB3L4)
   04916 Melanogenesis
    101381943 (CREB3L4)
   04925 Aldosterone synthesis and secretion
    101381943 (CREB3L4)
   04927 Cortisol synthesis and secretion
    101381943 (CREB3L4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101381943 (CREB3L4)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101381943 (CREB3L4)
  09156 Nervous system
   04725 Cholinergic synapse
    101381943 (CREB3L4)
   04728 Dopaminergic synapse
    101381943 (CREB3L4)
  09149 Aging
   04211 Longevity regulating pathway
    101381943 (CREB3L4)
  09159 Environmental adaptation
   04714 Thermogenesis
    101381943 (CREB3L4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101381943 (CREB3L4)
  09162 Cancer: specific types
   05215 Prostate cancer
    101381943 (CREB3L4)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101381943 (CREB3L4)
   05020 Prion disease
    101381943 (CREB3L4)
  09165 Substance dependence
   05030 Cocaine addiction
    101381943 (CREB3L4)
   05031 Amphetamine addiction
    101381943 (CREB3L4)
   05034 Alcoholism
    101381943 (CREB3L4)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101381943 (CREB3L4)
   04934 Cushing syndrome
    101381943 (CREB3L4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101381943 (CREB3L4)
   05161 Hepatitis B
    101381943 (CREB3L4)
   05163 Human cytomegalovirus infection
    101381943 (CREB3L4)
   05165 Human papillomavirus infection
    101381943 (CREB3L4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oro03000]
    101381943 (CREB3L4)
Transcription factors [BR:oro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101381943 (CREB3L4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB HAUS-augmin3 VirE2 OmpH JMY Jnk-SapK_ap_N
Other DBs
NCBI-GeneID: 101381943
NCBI-ProteinID: XP_004403074
UniProt: A0A2U3W4T8
LinkDB
Position
Unknown
AA seq 393 aa
MDFRTPDLLDVWLEPPEEVSTGAFLELGLHCPPREVPGTKLQEQGLPGWERSGSRGCDLQ
ESEPEDFLKLFIDPNEVYCSEASPGSDSGISEDPGHPDSPPAPKAPNSPALYEVVYEAGA
LERMQGEAGPAVGLLSLQLDQRSPPLMVPDACTVLELPLDAHPHTLPRAGTANPVPPVTL
LPCQTLFLTEEEKRLLGQEGVSLPTHLPLTKAEERILKKVRRKIRNKQSAQDSRRRKKEY
IDGLESRAAACSAQNQELQKKVQELERHNISLVTQLRQLQVLIAQTSNKAAQTGTCALIL
LFSLALIVLPSVSPLQGLREAGTEDHQPHGVISRNILTHKDMTENLETTVVESRLEGPPR
AKGVNGSRTLLEKMGGKTGPSGHVRTGLHADEM
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggacttccgaacccccgacctgctggacgtgtggctggagcccccagaagaggtctca
acaggagccttcctggagctgggactccactgcccccctcgagaggtcccagggactaag
ctccaagaacagggtcttccaggctgggagcgcagcgggagccgtggctgtgaccttcaa
gagagtgagcctgaagatttcctgaagcttttcattgatcccaatgaagtgtactgctca
gaagcatctcctggtagtgacagtggaatctccgaggaccctggccatccagacagtcct
cctgcccccaaagcacccaattcccctgctctctatgaggttgtctatgaggcaggggcc
cttgagaggatgcaaggggaagctgggccagctgtagggctcctctctctccagctagat
cagcgaagcccaccacttatggtgcctgatgcttgcacggtcctcgagctgccccttgat
gctcaccctcacaccctgcccagagcgggcactgcaaacccagtgcctcctgtgaccctg
ctgccctgtcaaaccttgttcctgacagaggaggagaagcgtctgctgggacaggaaggg
gtttccctgcccactcacctgcctctcaccaaggcagaggagaggatcctcaagaaggtc
aggaggaagatccgcaacaagcagtcagctcaggacagtcggcgacggaagaaagagtac
atcgacgggctagagagcagggcggctgcctgttctgcacagaaccaggaactacagaaa
aaagtccaggagctggagaggcacaacatctccctggtaactcagctccgccagctgcag
gtgctcattgcccaaacctccaacaaagctgcccagaccggcacttgtgctctgatcctt
cttttttctctggctctcatcgtcctgcccagtgtcagccccttgcagggtctccgggaa
gctgggactgaggatcaccagcctcatggagtgatttccagaaatatcctgactcacaag
gacatgacagaaaatttggagaccacagtggtagagtccagattggaggggccacctagg
gccaagggtgtaaatggctcaaggaccctgctggagaagatgggagggaagacaggcccc
agtgggcatgtcagaactggcctgcatgcagatgagatgtga

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101383024
Entry
101383024         CDS       T05148                                 

Gene name
CREB1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 1 isoform X1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04022  cGMP-PKG signaling pathway
oro04024  cAMP signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04152  AMPK signaling pathway
oro04211  Longevity regulating pathway
oro04261  Adrenergic signaling in cardiomyocytes
oro04380  Osteoclast differentiation
oro04612  Antigen processing and presentation
oro04668  TNF signaling pathway
oro04710  Circadian rhythm
oro04713  Circadian entrainment
oro04714  Thermogenesis
oro04725  Cholinergic synapse
oro04728  Dopaminergic synapse
oro04911  Insulin secretion
oro04915  Estrogen signaling pathway
oro04916  Melanogenesis
oro04918  Thyroid hormone synthesis
oro04922  Glucagon signaling pathway
oro04924  Renin secretion
oro04925  Aldosterone synthesis and secretion
oro04926  Relaxin signaling pathway
oro04927  Cortisol synthesis and secretion
oro04928  Parathyroid hormone synthesis, secretion and action
oro04931  Insulin resistance
oro04934  Cushing syndrome
oro04935  Growth hormone synthesis, secretion and action
oro04962  Vasopressin-regulated water reabsorption
oro05016  Huntington disease
oro05020  Prion disease
oro05030  Cocaine addiction
oro05031  Amphetamine addiction
oro05034  Alcoholism
oro05152  Tuberculosis
oro05161  Hepatitis B
oro05163  Human cytomegalovirus infection
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05203  Viral carcinogenesis
oro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101383024 (CREB1)
   04024 cAMP signaling pathway
    101383024 (CREB1)
   04022 cGMP-PKG signaling pathway
    101383024 (CREB1)
   04151 PI3K-Akt signaling pathway
    101383024 (CREB1)
   04152 AMPK signaling pathway
    101383024 (CREB1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    101383024 (CREB1)
  09152 Endocrine system
   04911 Insulin secretion
    101383024 (CREB1)
   04922 Glucagon signaling pathway
    101383024 (CREB1)
   04915 Estrogen signaling pathway
    101383024 (CREB1)
   04926 Relaxin signaling pathway
    101383024 (CREB1)
   04935 Growth hormone synthesis, secretion and action
    101383024 (CREB1)
   04918 Thyroid hormone synthesis
    101383024 (CREB1)
   04928 Parathyroid hormone synthesis, secretion and action
    101383024 (CREB1)
   04916 Melanogenesis
    101383024 (CREB1)
   04924 Renin secretion
    101383024 (CREB1)
   04925 Aldosterone synthesis and secretion
    101383024 (CREB1)
   04927 Cortisol synthesis and secretion
    101383024 (CREB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101383024 (CREB1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101383024 (CREB1)
  09156 Nervous system
   04725 Cholinergic synapse
    101383024 (CREB1)
   04728 Dopaminergic synapse
    101383024 (CREB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101383024 (CREB1)
  09149 Aging
   04211 Longevity regulating pathway
    101383024 (CREB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    101383024 (CREB1)
   04713 Circadian entrainment
    101383024 (CREB1)
   04714 Thermogenesis
    101383024 (CREB1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101383024 (CREB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    101383024 (CREB1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101383024 (CREB1)
   05020 Prion disease
    101383024 (CREB1)
  09165 Substance dependence
   05030 Cocaine addiction
    101383024 (CREB1)
   05031 Amphetamine addiction
    101383024 (CREB1)
   05034 Alcoholism
    101383024 (CREB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101383024 (CREB1)
   04934 Cushing syndrome
    101383024 (CREB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101383024 (CREB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101383024 (CREB1)
   05161 Hepatitis B
    101383024 (CREB1)
   05163 Human cytomegalovirus infection
    101383024 (CREB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101383024 (CREB1)
   05165 Human papillomavirus infection
    101383024 (CREB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oro03000]
    101383024 (CREB1)
   03029 Mitochondrial biogenesis [BR:oro03029]
    101383024 (CREB1)
Transcription factors [BR:oro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101383024 (CREB1)
Mitochondrial biogenesis [BR:oro03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    101383024 (CREB1)
SSDB
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 101383024
NCBI-ProteinID: XP_004405459
UniProt: A0A2U3WAS2
LinkDB
Position
Unknown
AA seq 341 aa
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaccatggaatctggagcagagaaccagcagagtggagatgcagctgtaacagaagct
gaaaaccagcaaatgacagttcaagcccagccacagattgccacattagcccaggtatct
atgccagcagctcatgcaacatcatctgctcccaccgtaactttagtacagctgcccaat
gggcagacagttcaagtccatggcgttattcaggcggcccagccatcagttattcagtct
ccacaagtccagacagttcagtcttcctgtaaggacttaaaaaggcttttctccggaact
cagatttcaactattgcagaaagtgaagattcacaggagtcagtggatagtgtaactgat
tcccaaaaacgaagagaaattctttcaaggaggccttcctacaggaaaattttgaatgac
ttatcttcagatgcaccaggagtgccaaggattgaagaagagaagtctgaagaggagact
tcagcacctgccatcaccactgtaacggtgccaactccgatttaccaaactagcagcgga
cagtatattgccattacccagggaggagcaatacaactggctaacaatggtaccgatggg
gtacagggcctgcaaacattaaccatgaccaatgcagctgccactcagccgggtactacc
atcctacagtatgcacagaccactgatggacagcagatcttagtgcccagcaaccaagtc
gttgttcaagctgcctctggagatgtacagacataccagattcgcacagcacccactagc
accattgcccctggagttgttatggcatcctccccagcacttcctacacaacctgctgaa
gaagcagcccgaaagagagaggttcgcctaatgaagaacagggaagcagcacgagagtgt
cgtagaaagaagaaagaatatgtgaaatgtttagaaaacagagtggcagtgcttgaaaac
caaaataagacactcattgaggagctaaaagcacttaaggacctttactgccacaaatca
gattaa

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101383806
Entry
101383806         CDS       T05148                                 

Gene name
CREB3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04022  cGMP-PKG signaling pathway
oro04024  cAMP signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04152  AMPK signaling pathway
oro04211  Longevity regulating pathway
oro04261  Adrenergic signaling in cardiomyocytes
oro04668  TNF signaling pathway
oro04714  Thermogenesis
oro04725  Cholinergic synapse
oro04728  Dopaminergic synapse
oro04911  Insulin secretion
oro04915  Estrogen signaling pathway
oro04916  Melanogenesis
oro04918  Thyroid hormone synthesis
oro04922  Glucagon signaling pathway
oro04925  Aldosterone synthesis and secretion
oro04926  Relaxin signaling pathway
oro04927  Cortisol synthesis and secretion
oro04928  Parathyroid hormone synthesis, secretion and action
oro04931  Insulin resistance
oro04934  Cushing syndrome
oro04935  Growth hormone synthesis, secretion and action
oro04962  Vasopressin-regulated water reabsorption
oro05016  Huntington disease
oro05020  Prion disease
oro05030  Cocaine addiction
oro05031  Amphetamine addiction
oro05034  Alcoholism
oro05161  Hepatitis B
oro05163  Human cytomegalovirus infection
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05203  Viral carcinogenesis
oro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101383806 (CREB3)
   04024 cAMP signaling pathway
    101383806 (CREB3)
   04022 cGMP-PKG signaling pathway
    101383806 (CREB3)
   04151 PI3K-Akt signaling pathway
    101383806 (CREB3)
   04152 AMPK signaling pathway
    101383806 (CREB3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101383806 (CREB3)
   04922 Glucagon signaling pathway
    101383806 (CREB3)
   04915 Estrogen signaling pathway
    101383806 (CREB3)
   04926 Relaxin signaling pathway
    101383806 (CREB3)
   04935 Growth hormone synthesis, secretion and action
    101383806 (CREB3)
   04918 Thyroid hormone synthesis
    101383806 (CREB3)
   04928 Parathyroid hormone synthesis, secretion and action
    101383806 (CREB3)
   04916 Melanogenesis
    101383806 (CREB3)
   04925 Aldosterone synthesis and secretion
    101383806 (CREB3)
   04927 Cortisol synthesis and secretion
    101383806 (CREB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101383806 (CREB3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101383806 (CREB3)
  09156 Nervous system
   04725 Cholinergic synapse
    101383806 (CREB3)
   04728 Dopaminergic synapse
    101383806 (CREB3)
  09149 Aging
   04211 Longevity regulating pathway
    101383806 (CREB3)
  09159 Environmental adaptation
   04714 Thermogenesis
    101383806 (CREB3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101383806 (CREB3)
  09162 Cancer: specific types
   05215 Prostate cancer
    101383806 (CREB3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101383806 (CREB3)
   05020 Prion disease
    101383806 (CREB3)
  09165 Substance dependence
   05030 Cocaine addiction
    101383806 (CREB3)
   05031 Amphetamine addiction
    101383806 (CREB3)
   05034 Alcoholism
    101383806 (CREB3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101383806 (CREB3)
   04934 Cushing syndrome
    101383806 (CREB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101383806 (CREB3)
   05161 Hepatitis B
    101383806 (CREB3)
   05163 Human cytomegalovirus infection
    101383806 (CREB3)
   05165 Human papillomavirus infection
    101383806 (CREB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oro03000]
    101383806 (CREB3)
Transcription factors [BR:oro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101383806 (CREB3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 101383806
NCBI-ProteinID: XP_004392316
UniProt: A0A2U3VCL4
LinkDB
Position
Unknown
AA seq 352 aa
MDLALDLGDQDLLDFLLEESGDLGAEQPLSETLSEWEAEDFLSSLLSPPASLNVLSSSDS
CLVHHDHTYSLSQHVSIDLDGGNYGKEGAQTTPLRVEEPAEQEIARLILTDEEKRLLEKE
GLTLHGTLPLTKMEEQVLTRVRRKIRNKKSAQESRRKKKVYLGGLESRVLKYTAQNLELQ
NKVQLLEEQNLSLLDQLRRLQAMVIQVSDKTSSTSTCVLVLLFSFCLLIVPAMYSSDTRG
SLPAEHGVLSRQLRALPSEDPHQLELPALQSEVPKDSSDQEIQAPGNSCCLLYHMPQAPG
AEPPLKWPFPVPSSKSPCPGPALPLHANFTRDREWFPTHSPTSVILQGRYSG
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggacctggcgttggacttgggtgaccaggacctgctggacttcctgctagaggaaagc
ggagatttgggggccgagcagcccctctccgagacgctgagtgaatgggaggcagaggat
ttcctgagttccctgctgagtcctccagcatcgttgaacgtccttagctcctctgattcc
tgtcttgttcaccatgatcacacctactccctctcacaacatgtctccatagatctagat
ggtgggaactatggaaaagagggggcccagacgactccactgcgtgtggaggagccagca
gagcaggaaattgctaggctgatactgacagatgaggagaagaggctgttggagaaggag
gggcttactctgcatgggacacttcctcttactaagatggaggaacaagttctgacacga
gtgcggaggaaaattagaaacaaaaagtctgctcaggagagccgcaggaagaagaaggtg
tatttgggaggtttagagagcagggtcttgaaatacacagcccagaatctggagctacag
aacaaagtgcagctcctggaggaacagaatttgtcccttctggaccagctgaggagactc
caggccatggtgattcaggtgtcagacaaaacgagcagcaccagcacctgcgtcttggtc
ctacttttctccttctgtctgctcatcgtacctgctatgtactcctctgacacaaggggg
agcctgccagctgagcatggagtgttgtcccgccagcttcgtgccctccccagtgaggac
cctcaccagctggagctgcctgccctgcagtcagaggtaccaaaggacagttcagaccaa
gagatccaggctcctggcaactcttgctgcttgctgtaccacatgcctcaggctcctggt
gctgagcctcccctgaagtggccatttcctgtcccttcctcaaagtccccctgcccaggt
cccgcccttcccctgcatgcaaatttcacaagagatcgggaatggttccctactcacagc
cccacatctgttatcttacagggcagatattcaggctag

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101384862
Entry
101384862         CDS       T05148                                 

Gene name
CREB5
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 5
  KO
K09047  cyclic AMP-responsive element-binding protein 5
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04022  cGMP-PKG signaling pathway
oro04024  cAMP signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04152  AMPK signaling pathway
oro04211  Longevity regulating pathway
oro04261  Adrenergic signaling in cardiomyocytes
oro04668  TNF signaling pathway
oro04714  Thermogenesis
oro04725  Cholinergic synapse
oro04728  Dopaminergic synapse
oro04911  Insulin secretion
oro04915  Estrogen signaling pathway
oro04918  Thyroid hormone synthesis
oro04922  Glucagon signaling pathway
oro04925  Aldosterone synthesis and secretion
oro04926  Relaxin signaling pathway
oro04927  Cortisol synthesis and secretion
oro04928  Parathyroid hormone synthesis, secretion and action
oro04931  Insulin resistance
oro04934  Cushing syndrome
oro04935  Growth hormone synthesis, secretion and action
oro04962  Vasopressin-regulated water reabsorption
oro05016  Huntington disease
oro05020  Prion disease
oro05030  Cocaine addiction
oro05031  Amphetamine addiction
oro05034  Alcoholism
oro05161  Hepatitis B
oro05163  Human cytomegalovirus infection
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05203  Viral carcinogenesis
oro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101384862 (CREB5)
   04024 cAMP signaling pathway
    101384862 (CREB5)
   04022 cGMP-PKG signaling pathway
    101384862 (CREB5)
   04151 PI3K-Akt signaling pathway
    101384862 (CREB5)
   04152 AMPK signaling pathway
    101384862 (CREB5)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101384862 (CREB5)
   04922 Glucagon signaling pathway
    101384862 (CREB5)
   04915 Estrogen signaling pathway
    101384862 (CREB5)
   04926 Relaxin signaling pathway
    101384862 (CREB5)
   04935 Growth hormone synthesis, secretion and action
    101384862 (CREB5)
   04918 Thyroid hormone synthesis
    101384862 (CREB5)
   04928 Parathyroid hormone synthesis, secretion and action
    101384862 (CREB5)
   04925 Aldosterone synthesis and secretion
    101384862 (CREB5)
   04927 Cortisol synthesis and secretion
    101384862 (CREB5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101384862 (CREB5)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101384862 (CREB5)
  09156 Nervous system
   04725 Cholinergic synapse
    101384862 (CREB5)
   04728 Dopaminergic synapse
    101384862 (CREB5)
  09149 Aging
   04211 Longevity regulating pathway
    101384862 (CREB5)
  09159 Environmental adaptation
   04714 Thermogenesis
    101384862 (CREB5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101384862 (CREB5)
  09162 Cancer: specific types
   05215 Prostate cancer
    101384862 (CREB5)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101384862 (CREB5)
   05020 Prion disease
    101384862 (CREB5)
  09165 Substance dependence
   05030 Cocaine addiction
    101384862 (CREB5)
   05031 Amphetamine addiction
    101384862 (CREB5)
   05034 Alcoholism
    101384862 (CREB5)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101384862 (CREB5)
   04934 Cushing syndrome
    101384862 (CREB5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101384862 (CREB5)
   05161 Hepatitis B
    101384862 (CREB5)
   05163 Human cytomegalovirus infection
    101384862 (CREB5)
   05165 Human papillomavirus infection
    101384862 (CREB5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oro03000]
    101384862 (CREB5)
Transcription factors [BR:oro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    101384862 (CREB5)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB TolA_bind_tri NDUFB11 Cnn_1N DivIC
Other DBs
NCBI-GeneID: 101384862
NCBI-ProteinID: XP_004414019
UniProt: A0A2U3WX36
LinkDB
Position
Unknown
AA seq 369 aa
MFCTSGGNSASVMSMRPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPTMPGSSAVLMPME
RQMSVNSSLLGMQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAMSNGNMNTMGHMM
EMMGSRQDQTPHHHMHSHPHQHQTLPAHHPYPHQHQHPAHHPHPQPHHQQNHPHHHSHSH
LHAHPAHHQTSPHPPLHSGNQAQVSPATQQMQPTQTIQPPQPTGGRRRRVVDEDPDERRR
KFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQLKQLLLTHK
DCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTITTSSAVSEVVGSSTLSQLTT
HRTDLNPIL
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgttctgcacctcaggagggaattcagcctcagtgatgtccatgaggcctgtcccaggc
tctctatcttctctgctacatctccacaacagacagagacagcccatgccagcctccatg
cctgggaccctgcccaacccgacgatgccgggatcttctgccgtcttgatgccaatggag
agacagatgtcagtgaactccagcctcctgggaatgcaaggtccaaatctcagcaacccc
tgtgcttctccccaggtccagccaatgcattcagaagccaaaatgaggttgaaggctgcg
ttgactcaccacccagctgccatgtcaaatgggaatatgaacaccatgggacacatgatg
gagatgatgggctcccggcaggaccagacgccacaccaccacatgcactcacacccgcat
cagcaccagacactgccagcccatcacccgtacccacaccagcaccagcacccagcacac
catcctcaccctcaaccccatcaccagcagaaccacccacatcatcattcccactcccac
cttcacgcacaccctgcacatcaccagacctcgccacacccacccctgcactccggcaac
caagcacaggtctcaccagcgacacaacagatgcagccaacccagacaatacagccaccc
cagcccacaggggggcgccggcgaagggtggtggacgaggatcccgatgagaggcggagg
aaatttctggaacggaaccgggcagctgccacccgctgcagacagaagaggaaggtctgg
gtgatgtcactggaaaagaaagcagaagaactcacccagacaaacatgcagcttcagaat
gaagtgtccatgttgaaaaatgaggtggcacagctgaaacagttgttgttaacgcataaa
gactgtccaataacagccatgcagaaagaatcacaaggatatctaagtccggagagcagc
cctcctgccagccccgtcccagcttgctctcagcagcaggtcatccaacataataccatc
accacttcctccgcagtgagcgaggtggtgggaagctccaccctcagtcagcttaccact
cacagaacagacctgaatcccatcctttaa

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101385675
Entry
101385675         CDS       T05148                                 

Gene name
CREB3L2
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 2
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04022  cGMP-PKG signaling pathway
oro04024  cAMP signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04152  AMPK signaling pathway
oro04211  Longevity regulating pathway
oro04261  Adrenergic signaling in cardiomyocytes
oro04668  TNF signaling pathway
oro04714  Thermogenesis
oro04725  Cholinergic synapse
oro04728  Dopaminergic synapse
oro04911  Insulin secretion
oro04915  Estrogen signaling pathway
oro04916  Melanogenesis
oro04918  Thyroid hormone synthesis
oro04922  Glucagon signaling pathway
oro04925  Aldosterone synthesis and secretion
oro04926  Relaxin signaling pathway
oro04927  Cortisol synthesis and secretion
oro04928  Parathyroid hormone synthesis, secretion and action
oro04931  Insulin resistance
oro04934  Cushing syndrome
oro04935  Growth hormone synthesis, secretion and action
oro04962  Vasopressin-regulated water reabsorption
oro05016  Huntington disease
oro05020  Prion disease
oro05030  Cocaine addiction
oro05031  Amphetamine addiction
oro05034  Alcoholism
oro05161  Hepatitis B
oro05163  Human cytomegalovirus infection
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05203  Viral carcinogenesis
oro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101385675 (CREB3L2)
   04024 cAMP signaling pathway
    101385675 (CREB3L2)
   04022 cGMP-PKG signaling pathway
    101385675 (CREB3L2)
   04151 PI3K-Akt signaling pathway
    101385675 (CREB3L2)
   04152 AMPK signaling pathway
    101385675 (CREB3L2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101385675 (CREB3L2)
   04922 Glucagon signaling pathway
    101385675 (CREB3L2)
   04915 Estrogen signaling pathway
    101385675 (CREB3L2)
   04926 Relaxin signaling pathway
    101385675 (CREB3L2)
   04935 Growth hormone synthesis, secretion and action
    101385675 (CREB3L2)
   04918 Thyroid hormone synthesis
    101385675 (CREB3L2)
   04928 Parathyroid hormone synthesis, secretion and action
    101385675 (CREB3L2)
   04916 Melanogenesis
    101385675 (CREB3L2)
   04925 Aldosterone synthesis and secretion
    101385675 (CREB3L2)
   04927 Cortisol synthesis and secretion
    101385675 (CREB3L2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101385675 (CREB3L2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101385675 (CREB3L2)
  09156 Nervous system
   04725 Cholinergic synapse
    101385675 (CREB3L2)
   04728 Dopaminergic synapse
    101385675 (CREB3L2)
  09149 Aging
   04211 Longevity regulating pathway
    101385675 (CREB3L2)
  09159 Environmental adaptation
   04714 Thermogenesis
    101385675 (CREB3L2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101385675 (CREB3L2)
  09162 Cancer: specific types
   05215 Prostate cancer
    101385675 (CREB3L2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101385675 (CREB3L2)
   05020 Prion disease
    101385675 (CREB3L2)
  09165 Substance dependence
   05030 Cocaine addiction
    101385675 (CREB3L2)
   05031 Amphetamine addiction
    101385675 (CREB3L2)
   05034 Alcoholism
    101385675 (CREB3L2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101385675 (CREB3L2)
   04934 Cushing syndrome
    101385675 (CREB3L2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101385675 (CREB3L2)
   05161 Hepatitis B
    101385675 (CREB3L2)
   05163 Human cytomegalovirus infection
    101385675 (CREB3L2)
   05165 Human papillomavirus infection
    101385675 (CREB3L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oro03000]
    101385675 (CREB3L2)
Transcription factors [BR:oro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101385675 (CREB3L2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf HAUS6_N JMY HAUS-augmin3
Other DBs
NCBI-GeneID: 101385675
NCBI-ProteinID: XP_004416553
UniProt: A0A2U3X324
LinkDB
Position
Unknown
AA seq 519 aa
MEVLESGEQSVLQWDRKLSELSEPGETEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEK
SVSMEVEPSPTSPAPLIQAEHSYSLCEEPRAQSPFTHVTTGDSVHDDEVESEKWYLSTDF
PSTTIKTEPITEEPPPGLVPSVTLTITAISTPFEKEEPPLEMNTGVDSLCQTVIPKIKLE
PHEVDQFLNFSPKEASVEHLHLPPTPPSSHSSDSEGSLSPNPRLHPFGLPQTHSPARAVA
RAPSALSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLTKSEEKALKKIRR
KIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTL
VMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFQGYGPYPSATKMALPSQHSVQEPYTA
SVVRSRNLLIYEEHSPLEEPSSPASAGELGHWDRGSSLLRASGLETRPDVDLPHFIISNE
TSLEKSVLLELQQHLVGAQLEGNETLKVVELDRRVNATF
NT seq 1560 nt   +upstreamnt  +downstreamnt
atggaggtgctggagagcggggagcagagcgtcctgcagtgggaccgcaagctgagcgag
ctgtcagagcccggggaaaccgaggctcttatgtaccacacgcacttctcagaactcctg
gatgagttttcccagaacgtgttgggtcagctcctgaatgaccctttcctctcagagaag
agcgtgtcgatggaggtggagccatccccaacatccccggcgcctctcatccaggccgag
cacagctactccctgtgtgaggagcctcgggcccagtcaccattcacccacgttaccacc
ggtgacagcgtccatgacgatgaagtggaaagtgagaaatggtacctgtctacagacttt
ccatcaacaaccatcaagacagagccaattacagaggagccacccccaggacttgttccc
tctgtcactctgaccatcactgccatctccaccccttttgagaaggaggaaccccccctg
gaaatgaatactggggttgattccttgtgccagaccgttattcctaaaattaagctggag
cctcatgaagtggatcagttcctcaacttctctcctaaagaagcctccgtggaacacttg
cacttacctcccacccctcccagcagccacagcagtgactcagagggcagcctgagcccc
aacccgcgcctgcaccccttcggcctgcctcagacccacagccccgccagagccgtggcc
cgggccccctcggccctgtccagctctcctctcctcacggcgcctcacaaacttcaagga
tcaggcccactggtcctgacagaagaggagaagaggaccctgatcgccgagggctatccc
atccccaccaaattgcctctaacaaaatcagaggagaaggctctgaagaaaattcggagg
aaaatcaagaacaagatttctgcccaggaaagtaggagaaagaagaaagaatacatggac
agcttggagaaaaaggtggagtcttgttcaactgagaacttggagcttcggaagaaggta
gaggttctggagaacaccaacagaactctcctgcagcaactgcagaagcttcagactttg
gtgatgggcaaggtttcacgcacctgcaagttggcgggcacgcagactggcacatgcctc
atggtggttgtgctatgctttgctgttgcatttggcagctttcagggctacgggccctat
ccttctgccaccaagatggctctgcccagccagcattctgtgcaggagccgtatacagcc
tctgtcgtgagatccaggaatctgctgatctacgaggaacattctcccctggaggagccg
tccagcccagcctcggctggggagcttgggcattgggacagagggtcctctctgctcagg
gcatcagggttggagaccaggcctgatgtggatcttccccatttcattatctccaatgag
accagcctggagaaatcagtgctgttggagctacagcagcacttggtcggcgcccaactg
gaggggaatgagacactaaaagttgtagaactcgacagaagagtgaacgccaccttctaa

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101385783
Entry
101385783         CDS       T05148                                 

Gene name
CREB3L1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04022  cGMP-PKG signaling pathway
oro04024  cAMP signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04152  AMPK signaling pathway
oro04211  Longevity regulating pathway
oro04261  Adrenergic signaling in cardiomyocytes
oro04668  TNF signaling pathway
oro04714  Thermogenesis
oro04725  Cholinergic synapse
oro04728  Dopaminergic synapse
oro04911  Insulin secretion
oro04915  Estrogen signaling pathway
oro04916  Melanogenesis
oro04918  Thyroid hormone synthesis
oro04922  Glucagon signaling pathway
oro04925  Aldosterone synthesis and secretion
oro04926  Relaxin signaling pathway
oro04927  Cortisol synthesis and secretion
oro04928  Parathyroid hormone synthesis, secretion and action
oro04931  Insulin resistance
oro04934  Cushing syndrome
oro04935  Growth hormone synthesis, secretion and action
oro04962  Vasopressin-regulated water reabsorption
oro05016  Huntington disease
oro05020  Prion disease
oro05030  Cocaine addiction
oro05031  Amphetamine addiction
oro05034  Alcoholism
oro05161  Hepatitis B
oro05163  Human cytomegalovirus infection
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05203  Viral carcinogenesis
oro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101385783 (CREB3L1)
   04024 cAMP signaling pathway
    101385783 (CREB3L1)
   04022 cGMP-PKG signaling pathway
    101385783 (CREB3L1)
   04151 PI3K-Akt signaling pathway
    101385783 (CREB3L1)
   04152 AMPK signaling pathway
    101385783 (CREB3L1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101385783 (CREB3L1)
   04922 Glucagon signaling pathway
    101385783 (CREB3L1)
   04915 Estrogen signaling pathway
    101385783 (CREB3L1)
   04926 Relaxin signaling pathway
    101385783 (CREB3L1)
   04935 Growth hormone synthesis, secretion and action
    101385783 (CREB3L1)
   04918 Thyroid hormone synthesis
    101385783 (CREB3L1)
   04928 Parathyroid hormone synthesis, secretion and action
    101385783 (CREB3L1)
   04916 Melanogenesis
    101385783 (CREB3L1)
   04925 Aldosterone synthesis and secretion
    101385783 (CREB3L1)
   04927 Cortisol synthesis and secretion
    101385783 (CREB3L1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101385783 (CREB3L1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101385783 (CREB3L1)
  09156 Nervous system
   04725 Cholinergic synapse
    101385783 (CREB3L1)
   04728 Dopaminergic synapse
    101385783 (CREB3L1)
  09149 Aging
   04211 Longevity regulating pathway
    101385783 (CREB3L1)
  09159 Environmental adaptation
   04714 Thermogenesis
    101385783 (CREB3L1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101385783 (CREB3L1)
  09162 Cancer: specific types
   05215 Prostate cancer
    101385783 (CREB3L1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101385783 (CREB3L1)
   05020 Prion disease
    101385783 (CREB3L1)
  09165 Substance dependence
   05030 Cocaine addiction
    101385783 (CREB3L1)
   05031 Amphetamine addiction
    101385783 (CREB3L1)
   05034 Alcoholism
    101385783 (CREB3L1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101385783 (CREB3L1)
   04934 Cushing syndrome
    101385783 (CREB3L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101385783 (CREB3L1)
   05161 Hepatitis B
    101385783 (CREB3L1)
   05163 Human cytomegalovirus infection
    101385783 (CREB3L1)
   05165 Human papillomavirus infection
    101385783 (CREB3L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oro03000]
    101385783 (CREB3L1)
Transcription factors [BR:oro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101385783 (CREB3L1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf LMBR1 ELP6 Jnk-SapK_ap_N Spc29 TPR_MLP1_2 Prominin APG6_N HAUS-augmin3 JMY RNase_Y_N DUF4404 ADIP DUF724
Other DBs
NCBI-GeneID: 101385783
NCBI-ProteinID: XP_004399623
UniProt: A0A2U3VVY6
LinkDB
Position
Unknown
AA seq 520 aa
MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFAENMEDFSNDLFSSFFD
DPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDVEHGAWVLG
HKLCSVMVKQEQSLELPVDPLAASSAMAAAAAMATTPLLGLSPLSRLPVPHQAPGEMTQL
PVIKAEPQEVNQFLKVTPEDLVQMPLTPPSSHGSDSDGSQSPRSLPPSSPVRPMARSSTA
ISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKN
KISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANRTLLQQLQKLQTLVTNK
ISRPYKMAATQTGTCLMVAALCFVLVLGSLVPCLPEFSSSSQTVKEDPMAADSVYTASQM
PSRSLLFYDEGAGSWEEGRSALLPVEPPDSWEIKPGGAAEQRPQDHLQHDHLDSTHETTK
YLSEAWPKDVGGNGTSPDFSHPKEWFRERDLGPNTTIKLS
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggacgccgtcttggagcccttccccgccgacaggctgttccccggatccagcttcctg
gacttgggggacctgaacgagtcggatttcctcaacaatgcgcacttcccggagcacctg
gaccactttgcggagaacatggaggacttctccaacgatctgttcagcagtttctttgat
gaccccgtgctggacgagaagagccctctactggacatggaactggactcccccacacca
ggcatccaggctgagcacagctactccctgagtggtgactcggcgcctcagagccccctt
gtgcccatcaagatggaggacaccacccaagacgtggaacatggagcatgggtgctggga
cacaaactgtgctccgtcatggtgaagcaggagcagagcctggagctgcccgtggaccct
ctggccgcctcctcggccatggccgccgctgccgccatggccaccaccccactgctgggc
ctcagccccctgtccaggctgcccgtcccccaccaggccccaggagagatgactcagctg
ccagtgatcaaagcagagccccaggaggtgaatcagttcctcaaagtgacaccagaggac
ctggtgcagatgcctctgacgccccccagcagccacggcagcgacagtgacggctcccag
agtccccgctctctgcccccctccagccctgtccggcccatggcccgctcctccacggcc
atctccacctccccccttctcaccgcccctcacaaattacaggggacatcagggccactg
ctcctgacagaggaggagaaacgcaccctgattgctgagggctaccccatccccacgaaa
ctccccctcaccaaagccgaagaaaaggccttaaagagggtccggagaaaaatcaagaat
aagatctcggcccaggagagccgccgtaagaagaaggagtacgtggaatgtctagaaaag
aaggtggagacatttacatcagagaacaacgaactgtggaagaaggtagagaccctggag
aatgccaacaggaccctgctccagcagctgcagaaacttcagactctggtcaccaacaag
atctcaagaccttacaagatggccgccacccagactgggacctgcctcatggtggcagcc
ctgtgcttcgttctggtgctgggctccttggtgccctgcctccctgagttctcctccagt
tcccagactgtgaaggaagaccccatggccgctgacagcgtctacacagccagtcagatg
ccctcccggagcctcctgttctatgacgagggggcaggctcgtgggaggagggccgcagt
gccctgctgcctgtggagcccccagacagctgggaaatcaagccggggggggcggctgag
cagcggccccaggaccacctgcagcatgaccacctggacagcacccacgagaccaccaag
tacctgagtgaggcctggccaaaagacgttggtggaaacggcaccagccccgacttctct
caccccaaggagtggttccgtgagagggatctgggccccaataccaccatcaaactctcc
tag

DBGET integrated database retrieval system