KEGG   Odobenus rosmarus divergens (Pacific walrus): 101368207
Entry
101368207         CDS       T05148                                 

Gene name
JUN
Definition
(RefSeq) transcription factor AP-1 isoform X1
  KO
K04448  transcription factor AP-1
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01522  Endocrine resistance
oro04010  MAPK signaling pathway
oro04012  ErbB signaling pathway
oro04024  cAMP signaling pathway
oro04137  Mitophagy - animal
oro04210  Apoptosis
oro04310  Wnt signaling pathway
oro04380  Osteoclast differentiation
oro04510  Focal adhesion
oro04530  Tight junction
oro04620  Toll-like receptor signaling pathway
oro04621  NOD-like receptor signaling pathway
oro04625  C-type lectin receptor signaling pathway
oro04657  IL-17 signaling pathway
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro04662  B cell receptor signaling pathway
oro04668  TNF signaling pathway
oro04722  Neurotrophin signaling pathway
oro04912  GnRH signaling pathway
oro04915  Estrogen signaling pathway
oro04921  Oxytocin signaling pathway
oro04926  Relaxin signaling pathway
oro04932  Non-alcoholic fatty liver disease
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro05030  Cocaine addiction
oro05031  Amphetamine addiction
oro05132  Salmonella infection
oro05133  Pertussis
oro05135  Yersinia infection
oro05140  Leishmaniasis
oro05142  Chagas disease
oro05161  Hepatitis B
oro05162  Measles
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05169  Epstein-Barr virus infection
oro05170  Human immunodeficiency virus 1 infection
oro05171  Coronavirus disease - COVID-19
oro05200  Pathways in cancer
oro05203  Viral carcinogenesis
oro05210  Colorectal cancer
oro05211  Renal cell carcinoma
oro05224  Breast cancer
oro05231  Choline metabolism in cancer
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oro05321  Inflammatory bowel disease
oro05323  Rheumatoid arthritis
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101368207 (JUN)
   04012 ErbB signaling pathway
    101368207 (JUN)
   04310 Wnt signaling pathway
    101368207 (JUN)
   04668 TNF signaling pathway
    101368207 (JUN)
   04024 cAMP signaling pathway
    101368207 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101368207 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    101368207 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101368207 (JUN)
   04530 Tight junction
    101368207 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101368207 (JUN)
   04621 NOD-like receptor signaling pathway
    101368207 (JUN)
   04625 C-type lectin receptor signaling pathway
    101368207 (JUN)
   04660 T cell receptor signaling pathway
    101368207 (JUN)
   04658 Th1 and Th2 cell differentiation
    101368207 (JUN)
   04659 Th17 cell differentiation
    101368207 (JUN)
   04657 IL-17 signaling pathway
    101368207 (JUN)
   04662 B cell receptor signaling pathway
    101368207 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101368207 (JUN)
   04915 Estrogen signaling pathway
    101368207 (JUN)
   04921 Oxytocin signaling pathway
    101368207 (JUN)
   04926 Relaxin signaling pathway
    101368207 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101368207 (JUN)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101368207 (JUN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101368207 (JUN)
   05203 Viral carcinogenesis
    101368207 (JUN)
   05231 Choline metabolism in cancer
    101368207 (JUN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101368207 (JUN)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101368207 (JUN)
   05211 Renal cell carcinoma
    101368207 (JUN)
   05224 Breast cancer
    101368207 (JUN)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101368207 (JUN)
   05321 Inflammatory bowel disease
    101368207 (JUN)
  09165 Substance dependence
   05030 Cocaine addiction
    101368207 (JUN)
   05031 Amphetamine addiction
    101368207 (JUN)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101368207 (JUN)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101368207 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101368207 (JUN)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101368207 (JUN)
   05135 Yersinia infection
    101368207 (JUN)
   05133 Pertussis
    101368207 (JUN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101368207 (JUN)
   05170 Human immunodeficiency virus 1 infection
    101368207 (JUN)
   05161 Hepatitis B
    101368207 (JUN)
   05171 Coronavirus disease - COVID-19
    101368207 (JUN)
   05162 Measles
    101368207 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101368207 (JUN)
   05169 Epstein-Barr virus infection
    101368207 (JUN)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    101368207 (JUN)
   05142 Chagas disease
    101368207 (JUN)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101368207 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oro03000]
    101368207 (JUN)
Transcription factors [BR:oro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    101368207 (JUN)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 FlaC_arch NBP1 TFIIA Jnk-SapK_ap_N Fib_alpha DUF3450
Other DBs
NCBI-GeneID: 101368207
NCBI-ProteinID: XP_004415066
UniProt: A0A2U3WZD8
LinkDB
Position
Unknown
AA seq 335 aa
MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPNVTSAAQPVSGAGMVAPAVASAAGGSGGGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQPQQQPPQPPHHLPQQLPVQHPRLQALKEEPQTVPEMP
GETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAS
TANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag
tccgagagcggcgcctacggctacagtaaccccaagatcctgaaacagagcatgaccctg
aacctggccgacccggtgggcagcctgaagccgcacctccgggccaagaactcggacctc
ctcacctcgcccgacgtggggttgctcaagctggcctcgcccgagctggagcgcctgata
atccagtccagcaacgggcacatcaccaccacgccgaccccgacgcagttcctgtgcccc
aagaacgtgacagacgagcaggagggcttcgcagaaggtttcgtgcgcgccctggccgaa
ctgcacagccagaacacgctgcccaacgtcacgtcggcggcgcagccggtcagcggtgcg
ggcatggtggctccggccgtggcttcggcggcgggcggcagcggcggcggcggcttcagc
gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaacccgggcgcg
ctgagcagcggcggcggggcgccctcgtacggcgcggccggcctggcctttcccgcgcag
ccccagcagccgcagcagcagcccccgcagccgccgcaccacctgccccagcagctccca
gtgcagcacccgcggctgcaggccttgaaggaggagccgcagacggtgcccgagatgccc
ggggaaacgccgcccctgtcccccatcgacatggagtcacaggagaggatcaaggccgag
aggaagcgcatgaggaaccgcatagctgcctccaagtgccggaaaaggaagctggagagg
atcgcccggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtcc
acggccaacatgctcagggaacaggtggcacagcttaaacaaaaagtcatgaaccacgtt
aacagtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system