KEGG   Odobenus rosmarus divergens (Pacific walrus): 101368209
Entry
101368209         CDS       T05148                                 

Gene name
TNF
Definition
(RefSeq) tumor necrosis factor
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01523  Antifolate resistance
oro04010  MAPK signaling pathway
oro04060  Cytokine-cytokine receptor interaction
oro04061  Viral protein interaction with cytokine and cytokine receptor
oro04064  NF-kappa B signaling pathway
oro04071  Sphingolipid signaling pathway
oro04150  mTOR signaling pathway
oro04210  Apoptosis
oro04217  Necroptosis
oro04350  TGF-beta signaling pathway
oro04380  Osteoclast differentiation
oro04612  Antigen processing and presentation
oro04620  Toll-like receptor signaling pathway
oro04621  NOD-like receptor signaling pathway
oro04622  RIG-I-like receptor signaling pathway
oro04625  C-type lectin receptor signaling pathway
oro04640  Hematopoietic cell lineage
oro04650  Natural killer cell mediated cytotoxicity
oro04657  IL-17 signaling pathway
oro04660  T cell receptor signaling pathway
oro04664  Fc epsilon RI signaling pathway
oro04668  TNF signaling pathway
oro04920  Adipocytokine signaling pathway
oro04930  Type II diabetes mellitus
oro04931  Insulin resistance
oro04932  Non-alcoholic fatty liver disease
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro04940  Type I diabetes mellitus
oro05010  Alzheimer disease
oro05014  Amyotrophic lateral sclerosis
oro05020  Prion disease
oro05022  Pathways of neurodegeneration - multiple diseases
oro05132  Salmonella infection
oro05133  Pertussis
oro05134  Legionellosis
oro05135  Yersinia infection
oro05140  Leishmaniasis
oro05142  Chagas disease
oro05143  African trypanosomiasis
oro05144  Malaria
oro05145  Toxoplasmosis
oro05146  Amoebiasis
oro05152  Tuberculosis
oro05160  Hepatitis C
oro05161  Hepatitis B
oro05163  Human cytomegalovirus infection
oro05164  Influenza A
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05168  Herpes simplex virus 1 infection
oro05169  Epstein-Barr virus infection
oro05170  Human immunodeficiency virus 1 infection
oro05171  Coronavirus disease - COVID-19
oro05205  Proteoglycans in cancer
oro05310  Asthma
oro05321  Inflammatory bowel disease
oro05322  Systemic lupus erythematosus
oro05323  Rheumatoid arthritis
oro05330  Allograft rejection
oro05332  Graft-versus-host disease
oro05410  Hypertrophic cardiomyopathy
oro05414  Dilated cardiomyopathy
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101368209 (TNF)
   04350 TGF-beta signaling pathway
    101368209 (TNF)
   04064 NF-kappa B signaling pathway
    101368209 (TNF)
   04668 TNF signaling pathway
    101368209 (TNF)
   04071 Sphingolipid signaling pathway
    101368209 (TNF)
   04150 mTOR signaling pathway
    101368209 (TNF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101368209 (TNF)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101368209 (TNF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101368209 (TNF)
   04217 Necroptosis
    101368209 (TNF)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101368209 (TNF)
   04620 Toll-like receptor signaling pathway
    101368209 (TNF)
   04621 NOD-like receptor signaling pathway
    101368209 (TNF)
   04622 RIG-I-like receptor signaling pathway
    101368209 (TNF)
   04625 C-type lectin receptor signaling pathway
    101368209 (TNF)
   04650 Natural killer cell mediated cytotoxicity
    101368209 (TNF)
   04612 Antigen processing and presentation
    101368209 (TNF)
   04660 T cell receptor signaling pathway
    101368209 (TNF)
   04657 IL-17 signaling pathway
    101368209 (TNF)
   04664 Fc epsilon RI signaling pathway
    101368209 (TNF)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101368209 (TNF)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101368209 (TNF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101368209 (TNF)
  09163 Immune disease
   05310 Asthma
    101368209 (TNF)
   05322 Systemic lupus erythematosus
    101368209 (TNF)
   05323 Rheumatoid arthritis
    101368209 (TNF)
   05321 Inflammatory bowel disease
    101368209 (TNF)
   05330 Allograft rejection
    101368209 (TNF)
   05332 Graft-versus-host disease
    101368209 (TNF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101368209 (TNF)
   05014 Amyotrophic lateral sclerosis
    101368209 (TNF)
   05020 Prion disease
    101368209 (TNF)
   05022 Pathways of neurodegeneration - multiple diseases
    101368209 (TNF)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101368209 (TNF)
   05410 Hypertrophic cardiomyopathy
    101368209 (TNF)
   05414 Dilated cardiomyopathy
    101368209 (TNF)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101368209 (TNF)
   04940 Type I diabetes mellitus
    101368209 (TNF)
   04932 Non-alcoholic fatty liver disease
    101368209 (TNF)
   04931 Insulin resistance
    101368209 (TNF)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101368209 (TNF)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101368209 (TNF)
   05135 Yersinia infection
    101368209 (TNF)
   05133 Pertussis
    101368209 (TNF)
   05134 Legionellosis
    101368209 (TNF)
   05152 Tuberculosis
    101368209 (TNF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101368209 (TNF)
   05170 Human immunodeficiency virus 1 infection
    101368209 (TNF)
   05161 Hepatitis B
    101368209 (TNF)
   05160 Hepatitis C
    101368209 (TNF)
   05171 Coronavirus disease - COVID-19
    101368209 (TNF)
   05164 Influenza A
    101368209 (TNF)
   05168 Herpes simplex virus 1 infection
    101368209 (TNF)
   05163 Human cytomegalovirus infection
    101368209 (TNF)
   05169 Epstein-Barr virus infection
    101368209 (TNF)
   05165 Human papillomavirus infection
    101368209 (TNF)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101368209 (TNF)
   05144 Malaria
    101368209 (TNF)
   05145 Toxoplasmosis
    101368209 (TNF)
   05140 Leishmaniasis
    101368209 (TNF)
   05142 Chagas disease
    101368209 (TNF)
   05143 African trypanosomiasis
    101368209 (TNF)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    101368209 (TNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oro04052]
    101368209 (TNF)
   00536 Glycosaminoglycan binding proteins [BR:oro00536]
    101368209 (TNF)
Cytokines and growth factors [BR:oro04052]
 Cytokines
  Tumor necrosis fators
   101368209 (TNF)
Glycosaminoglycan binding proteins [BR:oro00536]
 Heparan sulfate / Heparin
  Cytokines
   101368209 (TNF)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 101368209
NCBI-ProteinID: XP_004415279
UniProt: A0A2U3X072
LinkDB
Position
Unknown
AA seq 233 aa
MSTESMIRDVELAEEALPKKAGGPQGSRRCLCLSLFSFLLVAGATTLFCLLHFGVIGPQR
EELPDGLQLINPLAQTVKSSSRTPSDKPVAHVVANPEAEGQLQWLNRRANALLANGVELT
DNQLIVPSDGLYLIYSQVLFKGQGCPSTHVLLTHTISRFAVSYQTKVNLLSAIKSPCQRE
TPEGTEAKPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL
NT seq 702 nt   +upstreamnt  +downstreamnt
atgagcactgaaagcatgatccgggacgtggagctggccgaggaggcactccccaagaag
gcagggggcccccagggctccagaaggtgcttgtgcctcagcctcttctccttcctcctg
gttgcaggggccaccacgctcttctgcctgctgcactttggagtgatcggcccccagagg
gaagagctcccagatggcctccaactaatcaaccctctggcccagacagtcaaatcatct
tctcgaactccaagtgacaagcctgtagctcacgttgtagcaaaccccgaagctgagggg
caactccagtggctgaaccggcgtgccaatgccctcctggccaatggtgtggagctgaca
gacaaccagctaatagtgccatcagacgggctgtatctcatctactcccaggtcctcttc
aagggccaaggatgcccttccacccatgtgctcctcacccacaccatcagccgcttcgcc
gtctcctaccagaccaaggtcaacctcctctctgccatcaagagcccttgccaaagggag
accccagaggggactgaggccaagccctggtacgagcccatctacctgggaggggtcttc
caactggagaagggtgatcgactcagcgctgagatcaacctgcctgactatctcgacttt
gccgagtccgggcaggtctactttggaatcattgccctgtga

DBGET integrated database retrieval system