KEGG   Odobenus rosmarus divergens (Pacific walrus): 101368250
Entry
101368250         CDS       T05148                                 

Gene name
RBPJ
Definition
(RefSeq) recombining binding protein suppressor of hairless isoform X1
  KO
K06053  recombining binding protein suppressor of hairless
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04330  Notch signaling pathway
oro04658  Th1 and Th2 cell differentiation
oro05017  Spinocerebellar ataxia
oro05165  Human papillomavirus infection
oro05169  Epstein-Barr virus infection
oro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101368250 (RBPJ)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101368250 (RBPJ)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101368250 (RBPJ)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    101368250 (RBPJ)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101368250 (RBPJ)
   05165 Human papillomavirus infection
    101368250 (RBPJ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oro03000]
    101368250 (RBPJ)
Transcription factors [BR:oro03000]
 Eukaryotic type
  Other transcription factors
   Others
    101368250 (RBPJ)
SSDB
Motif
Pfam: BTD LAG1-DNAbind TIG RHD_dimer
Other DBs
NCBI-GeneID: 101368250
NCBI-ProteinID: XP_004402926
UniProt: A0A2U3W4D6
LinkDB
Position
Unknown
AA seq 500 aa
MDHTEGSPAEEPPAHAPSLGKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSY
GNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGK
NYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLC
IASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFYIHLLDDDESEGEEFTVRDG
YIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCL
SQERIIQFQATPCPKEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESL
QLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQ
PVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRASSGQVPPNESNTNSEGG
YTNVSTNSTSVTSSAATVVS
NT seq 1503 nt   +upstreamnt  +downstreamnt
atggaccacactgagggctcgcccgcggaggagccgcctgcgcatgctccatcgcttgga
aaatttggtgagcggcctccacctaaacgactcactagggaagctatgcgaaattactta
aaagagcgaggggatcaaacagtacttattcttcatgcaaaagttgcacagaagtcatat
ggaaatgaaaaaaggtttttttgccctcctccttgtgtgtatcttatgggcagtggatgg
aagaaaaaaaaagaacaaatggaacgagatggttgttctgaacaagagtctcaaccatgt
gcttttattggaataggaaatagtgaccaagaaatgcagcagctgaacttggaaggaaag
aactattgcacagccaaaacattgtacatatctgattcagacaagagaaagcacttcatg
ttgtctgtaaagatgttctacggcaacagcgatgacatcggtgtgttcctcagcaagcgg
ataaaagtcatttccaaaccttccaaaaagaagcagtcattgaaaaatgctgacttgtgc
attgcctcaggaacaaaggttgctctgtttaatcgacttcgatcccagacagttagtacc
agatacttgcatgtagaaggaggtaatttccatgccagttctcagcagtggggagcattt
tacattcatctcttggatgatgatgaatcagaaggagaagaattcacagttcgcgatggc
tacatccactacggacaaacagtcaaacttgtgtgttctgttactggcatggcactccca
agattgataattaggaaggttgataagcagaccgctttactggatgcagatgatcctgtg
tcacaactccataaatgtgcattttaccttaaggatactgaaagaatgtacttgtgcctt
tctcaagaaagaataatccagtttcaggccactccatgcccaaaagaaccaaataaagag
atgataaatgatggagcttcctggacaatcattagtacggataaggcggagtatacattt
tatgagggaatgggccctgtccttgccccagtcacccctgtgcctgtcgtagaaagtctt
cagttgaatggcggtggggacgtagcaatgcttgaacttacaggacagaatttcactcca
aatttacgagtgtggtttggggatgtagaagctgaaactatgtacagatgtggagagagc
atgctgtgtgttgtcccagacatttctgcattccgagaaggctggagatgggtccgacag
ccagtccaggtcccagtaactttggtccgtaacgatgggatcatttattccaccagcctt
acctttacctacacgccagaaccagggccacggccacactgcagtgccgcgggagccatc
cttcgagccagttcaggccaagtgccccctaatgaatcaaacacaaacagcgagggaggt
tatacaaacgtcagcacaaattcaaccagtgtcacatcctctgcagcaacagtggtgtcc
taa

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101384864
Entry
101384864         CDS       T05148                                 

Gene name
RBPJL
Definition
(RefSeq) recombining binding protein suppressor of hairless-like protein
  KO
K06053  recombining binding protein suppressor of hairless
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04330  Notch signaling pathway
oro04658  Th1 and Th2 cell differentiation
oro05017  Spinocerebellar ataxia
oro05165  Human papillomavirus infection
oro05169  Epstein-Barr virus infection
oro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101384864 (RBPJL)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101384864 (RBPJL)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101384864 (RBPJL)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    101384864 (RBPJL)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101384864 (RBPJL)
   05165 Human papillomavirus infection
    101384864 (RBPJL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oro03000]
    101384864 (RBPJL)
Transcription factors [BR:oro03000]
 Eukaryotic type
  Other transcription factors
   Others
    101384864 (RBPJL)
SSDB
Motif
Pfam: BTD LAG1-DNAbind
Other DBs
NCBI-GeneID: 101384864
NCBI-ProteinID: XP_004414175
UniProt: A0A2U3WX73
LinkDB
Position
Unknown
AA seq 517 aa
MDPIRATDPSAPPGPLTHLSLPDSSEARPQSGADGRSLPGNWTRSSPERVPVLREGVRQC
LQQRCEQTVRILHAKVAQKSYGNEKRFFCPPPCVYLAGPGWRVKPVQGQAHQAAETGPTV
CGYMGLDGASGSAAETQKLNFEEQPDSREFGCAKTLYISDADKRKHFRLVLRLVHRGGRE
LGTFHSRLIKVISKPSQKKQSLKNTDLCISSGSKVSLFNRLRSQTVSTRYLSVEDGAFVA
SARQWAAFTLHLADEHCSQGDFPPREGYVRYGSLVRLVCTVTGVTLPPMIIRKVAKQCAL
LDVDEPISQLHKCAFQFPGDPPGGVGTYLCLATDKVVQFQASPCPKEANRALLNDSSCWT
IIGTESVEFSFSTSLAWTREPVTPVPLISTLELSGGGDVATLELHGENFHAGLKVWFGDV
EAETMYRSPRSLVCVAPDIAAFGSDWRWLRTPITVPVSLVRADGLFYPSAFSFTYTPEYS
ARPRPPGDPEPAPDADALLESIHHEFTRTNFHLFIQT
NT seq 1554 nt   +upstreamnt  +downstreamnt
atggaccctatacgggcaacagacccctcagcgcccccaggccctttgactcacctgagc
ctgccggacagctcggaggcgcggccgcagagcggagccgacgggcggagcctcccgggc
aattggaccaggtcctccccagagcgcgtcccggtgctgagggaaggcgtgcgccagtgc
ctgcagcaacggtgtgagcagacagtgcggatcctgcacgccaaagtggcccagaagtcc
tacggaaatgagaagcggttcttctgccccccgccctgtgtctacctcgcaggtcccggc
tggagggtgaagccagtgcagggccaagcccaccaggcagcggaaaccgggcccacggtc
tgcggttacatgggactggacggcgcgtccggcagcgccgccgagacgcaaaagttgaat
tttgaagagcagccggactccagggaattcggttgcgccaagaccctgtacatctcggac
gcagacaagagaaagcacttccggctcgtgctgcggctggtgcaccgagggggccgagag
ctgggcaccttccacagccgcctcatcaaggtcatctcgaagccctcgcagaagaagcag
tcgctgaaaaacaccgacctgtgcatatcctcgggctcaaaggtctccctcttcaaccgc
ctgcgctcccagacagtgtccacgcgctacctctctgtggaggacggggcgttcgtggcc
agtgcgcgccagtgggctgccttcacgctccacctggctgatgaacactgttcccagggg
gacttcccgcctcgagagggctacgtccgctatggctccctagtgcgacttgtctgcact
gtcacaggcgtcacactacctccaatgatcatccgcaaagtagccaagcagtgcgcgctc
ctcgacgtggacgagcccatctcccaactgcacaagtgtgcattccagtttcctggtgat
cctcccggaggggttggcacttacttatgcctggctacagacaaggtggtgcaattccag
gcctccccctgccccaaggaggcaaacagggcgctactcaacgacagctcttgctggacc
atcatcggcactgagtcggtggagttctccttcagcaccagcctggcgtggacccgggag
ccagtcactccggtgcccctcatcagcaccctggagctgagcggtgggggcgacgtggcc
acgctggaactccacggtgagaacttccacgcggggctcaaggtgtggttcggggacgtg
gaggccgaaaccatgtacaggagcccgcggtccctggtgtgcgtggcgcccgacatagcc
gccttcggcagcgactggcgctggctgcgcacacccatcactgtgcccgtgagcctggtg
cgcgccgacggcctcttctaccccagcgccttctccttcacctacaccccggagtacagt
gcgcggccccggcccccgggcgaccctgagcccgctccggacgccgacgcgctcctcgag
agcatccaccacgagttcacgcgcaccaacttccacctcttcatccagacttag

DBGET integrated database retrieval system