KEGG   Odobenus rosmarus divergens (Pacific walrus): 101368251
Entry
101368251         CDS       T05148                                 

Gene name
IL6R
Definition
(RefSeq) interleukin-6 receptor subunit alpha
  KO
K05055  interleukin 6 receptor
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01521  EGFR tyrosine kinase inhibitor resistance
oro04060  Cytokine-cytokine receptor interaction
oro04061  Viral protein interaction with cytokine and cytokine receptor
oro04066  HIF-1 signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04630  JAK-STAT signaling pathway
oro04640  Hematopoietic cell lineage
oro04659  Th17 cell differentiation
oro04932  Non-alcoholic fatty liver disease
oro05163  Human cytomegalovirus infection
oro05171  Coronavirus disease - COVID-19
oro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101368251 (IL6R)
   04066 HIF-1 signaling pathway
    101368251 (IL6R)
   04151 PI3K-Akt signaling pathway
    101368251 (IL6R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101368251 (IL6R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101368251 (IL6R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101368251 (IL6R)
   04659 Th17 cell differentiation
    101368251 (IL6R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101368251 (IL6R)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101368251 (IL6R)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101368251 (IL6R)
   05163 Human cytomegalovirus infection
    101368251 (IL6R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101368251 (IL6R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:oro04050]
    101368251 (IL6R)
   04090 CD molecules [BR:oro04090]
    101368251 (IL6R)
Cytokine receptors [BR:oro04050]
 Interleukin receptor families
  IL6/12 receptor family
   101368251 (IL6R)
CD molecules [BR:oro04090]
 Proteins
  101368251 (IL6R)
SSDB
Motif
Pfam: IL6Ra-bind Ig_3 ig Ig_2 fn3 Big_4 Ig_5 I-set
Other DBs
NCBI-GeneID: 101368251
NCBI-ProteinID: XP_012418721
UniProt: A0A2U3ZJB5
LinkDB
Position
Unknown
AA seq 479 aa
MDTGLLSLPRQAVPTPRCVVHGRFMQELGDSGSFSRGLEEVVSDMVTSLPGASVTLTCPG
GEPGDKATVHWLLENYVAGSHQSSWAAMGRRLLLRSVQLSDSGNYSCYQDGRLAGTVRLL
VDVPPEEPQLACFRKSPLSKVACEWGPRRPPSPTTRATLLVRKFRSSPLGDSQELCLYSQ
GSRKFSCLLEVPEGDNSLYVVSLCVSNSAGSKSSKPHTFEGYGILQPDPPANVTVTAVDG
NPRWLSVTWKDPPSWNSYFYRLQFELRYRAERSQTFTTWMVQELQHHCIIHDAWRGMQHV
VQLRAREEFGHGSWSSWSQEATGTPWTESRSPPAESEAASSTQALTTNKDNESNLSKNPA
NATSLPVQDSSSVPLPAFLVAGGSLAFGTLLCVGIVLRFKKTWKLHTLKEGKASAHPPYS
LGQRVPERPKPTPVLVPLMSPPVSPSSLGSDSTSRHGRPDARGPQSPYDISNRDYFFPR
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggacacgggcctcctgtcccttccacgccaggctgtccccactcctcgatgcgtagtt
cacgggcgctttatgcaggagctgggggacagcggctcattctctaggggattggaggaa
gtggtgagtgatatggtgaccagcctgcctggggccagtgtgaccctgacctgcccgggc
ggggagccgggggacaaggccaccgttcactggctgctggagaactatgtggcaggctca
caccagagcagctgggctgccatgggaaggaggctgcttctgaggtcggtgcagctcagt
gactccggaaactattcatgttaccaggatggccgcctggctggaaccgtgcgtttgctg
gtggacgtgccccctgaggagccccagctcgcctgcttccggaagagtccgctcagcaag
gtagcctgtgagtggggtcctcggcgcccaccctccccgacgaccagggccacgttactg
gtgaggaagttccggagcagcccgctgggggactcccaggagctgtgcctgtattcccag
gggtcccggaagttctcctgcttgctggaggtcccggagggagacaactccttgtatgtc
gtgtccctgtgcgtcagcaacagtgctggaagcaagtccagcaaaccccacacgtttgag
ggctacggaatcttgcagcctgacccgcctgccaacgtcactgtcactgctgtggacgga
aacccccgctggctcagtgtcacctggaaagaccccccctcctggaactcctatttctac
aggctgcagtttgagctccggtaccgggctgaacggtcacagacgttcaccacgtggatg
gtccaggagctccagcaccactgcatcatccacgatgcctggagaggcatgcagcacgtg
gtgcagctccgggcgcgggaggagtttgggcacggctcctggagctcgtggagccaggag
gccacgggcaccccctggacagaatccaggagccctccagcggagagtgaggcggcgtcc
tccacgcaggcactgactactaacaaggacaatgaaagtaatctctctaaaaatcctgca
aatgcaaccagcctcccagtgcaagactcttcttcggtgccgctgcctgccttcctggtg
gccggaggaagcctggcctttgggactctcctgtgcgtcggcatcgtcctgaggttcaag
aagacgtggaagctgcacacgctgaaggagggcaaggcgagcgcgcacccgccgtactcg
ctgggacagcgggttcccgagaggcccaagcccaccccggtgctggtgcccctcatgtcc
ccgccggtgtcccccagcagccttgggtctgacagcacctcgaggcatggccgaccggat
gccaggggcccgcagagcccttacgacatcagcaacagagactacttcttccccagatag

DBGET integrated database retrieval system