KEGG   Odobenus rosmarus divergens (Pacific walrus): 101368722Help
Entry
101368722         CDS       T05148                                 

Gene name
GYS2
Definition
(RefSeq) glycogen [starch] synthase, liver isoform X1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00500  Starch and sucrose metabolism
oro01100  Metabolic pathways
oro04151  PI3K-Akt signaling pathway
oro04152  AMPK signaling pathway
oro04910  Insulin signaling pathway
oro04922  Glucagon signaling pathway
oro04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101368722 (GYS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101368722 (GYS2)
   04152 AMPK signaling pathway
    101368722 (GYS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101368722 (GYS2)
   04922 Glucagon signaling pathway
    101368722 (GYS2)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04931 Insulin resistance
    101368722 (GYS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:oro01003]
    101368722 (GYS2)
Enzymes [BR:oro01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     101368722 (GYS2)
Glycosyltransferases [BR:oro01003]
 Polysaccharide
  Storage polysaccharide
   101368722 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 GAPES3
Motif
Other DBs
NCBI-GeneID: 101368722
NCBI-ProteinID: XP_004405557
LinkDB All DBs
Position
Unknown
AA seq 703 aa AA seqDB search
MLQGRSLSVTSLSGLPQWEVEELPVEDLLLFEVAWEVTNKVGGIYTVIQTKAKTTADEWG
DNYFLIGPYFEHNMKTQVEQCEPINDAVRRAVDTMNKHGCQVHFGRWLIEGSPYVVLFDI
GYSAWNLDRWKGDLWEACNVGIPYHDREANDMLIFGSLTAWFLKEVTDHADGKHVIAQFH
EWQAGTGLILSRARKLPIATIFTTHATLLGRYLCAANIDFYNHLDKFNIDKEAGERQIYH
RYCMERASVHCAHVFTTVSEITAIEAEHVLKRKPDVVTPNGLNVKKFSAVHEFQNLHAMY
KARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLEALSRLNFLLRMHKSDV
TVVVFFIMPAKTNNFNVETLKGQAVRKQLWDIAHSVKEKFGKKLYDALLRGEIPDMDNIL
DRDDITIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNSRTDRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTSNLSGFGCFMQE
HVADPTAYGIYIVDRRFRSPDDSCNQLTQFLYGFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYQHARYLTLSKAFPDKFHMEPTSPPTTEGFKYPRPSSVPPSPSGSQVSSPQGSDVE
DEEEDGRYNEEEEAERDRLNIKSPFSLGRVPHGNKKLHDEYKN
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgctccaaggccgatctctatctgtgacatccctgagtgggcttcctcagtgggaagtt
gaagaacttcctgtggaggatttactgctttttgaagttgcttgggaagtaaccaataaa
gttggtggcatctatactgtgattcagacaaaggccaaaaccacagcagacgaatgggga
gacaattattttctgattggcccatattttgagcataatatgaagactcaggtggaacag
tgtgaacctataaatgatgctgttagaagggcagtggacacaatgaataaacatggctgc
caggtgcactttggaagatggctgatagaagggagtccttacgtggtgctctttgacata
ggctattctgcttggaacctggacaggtggaagggtgacctctgggaagcatgcaatgtt
ggcataccttaccatgaccgagaagcaaatgatatgctaatattcggatctttaactgcc
tggttcttaaaagaggtgacagatcatgcagatgggaaacatgtcattgcccaattccat
gaatggcaggcgggaactggactgatcctttctcgagctcggaaacttcccatcgctaca
atatttaccactcacgccacactgcttgggaggtatctctgtgcagcaaacattgatttc
tacaaccatctcgataagtttaacatagacaaagaggctggggaaaggcagatttaccac
cggtattgcatggagcgggcctctgtccattgtgctcatgtgttcaccacagtatccgaa
ataacagcaatagaagcagaacatgtgctgaagaggaagcctgatgtggttactccaaat
ggcttgaatgttaagaaattttcagcggtacatgagtttcaaaatctacatgccatgtac
aaggccaggatccaggattttgttcgaggtcatttctatggtcatctggactttgatctt
gaaaagactttgttccttttcattgctgggagatatgagttttccaacaaaggagctgac
atcttcctagaagccttatccaggctaaattttctgctgaggatgcataaaagtgacgtc
acagtggtggtgtttttcatcatgcctgccaagacaaataatttcaatgtggaaacgctg
aaaggccaggcagtgcggaaacagctatgggacattgcacattctgtgaaggaaaaattt
gggaagaaactgtatgatgcattgttacgaggagaaattcctgacatggacaacattttg
gatcgagatgatataacaattatgaaaagagccatcttttcaacccagcgacagtctttg
cctccagtgaccactcacaacatgattgatgactccactgatcccatcctcagcaccatt
agacggataggacttttcaacagccgcacggacagagtcaaggtaattttgcacccagag
tttctatcttccaccagccccttattacccatggattatgaagagtttgtccgaggttgt
catcttggagtatttccatcatactatgaaccgtggggttatactccagctgaatgcact
gtgatgggtatccccagtgtgacaagcaacctttccggctttggctgtttcatgcaggag
cacgtggctgatcctactgcttacggtatttacattgttgacaggaggttccgctctccg
gatgattcctgcaatcagctgactcagtttctctatggattttgcaaacagtcacgccgc
caaagaattattcagagaaaccgaactgagaggctctctgatcttctggattggagatac
ttgggcagatattatcagcatgccaggtacctgaccttaagcaaagcttttccagataaa
ttccatatggagcctacatcaccaccaacgactgaaggatttaaataccccaggccttct
tcagttccaccttccccttcagggtctcaggtctctagtcctcaaggcagtgatgtggaa
gacgaagaagaagatgggcgatacaatgaggaagaggaagctgaaagggatcggttaaat
atcaagtcgccattttctctgggccgtgttcctcatgggaataaaaagctgcatgatgaa
tacaagaactga

DBGET integrated database retrieval system