KEGG   Odobenus rosmarus divergens (Pacific walrus): 101368974Help
Entry
101368974         CDS       T05148                                 

Gene name
PYCR2
Definition
(RefSeq) pyrroline-5-carboxylate reductase 2 isoform X1
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00330  Arginine and proline metabolism
oro01100  Metabolic pathways
oro01230  Biosynthesis of amino acids
Module
oro_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    101368974 (PYCR2)
Enzymes [BR:oro01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     101368974 (PYCR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P5CR_dimer F420_oxidored Rossmann-like NAD_Gly3P_dh_N ApbA
Motif
Other DBs
NCBI-GeneID: 101368974
NCBI-ProteinID: XP_004393597
UniProt: A0A2U3VFU3
LinkDB All DBs
Position
Unknown
AA seq 320 aa AA seqDB search
MSVGFIGAGQLACALARGFTAAGILSAHKIIASSPEMDLPTVSSLRKMGVNLTRSNKETV
RHSDVLFLAVKPHIIPFILDEIGADVQARHIVVSCAAGVTISSVEKKLMAFQPAPKVIRC
MTNTPVVVREGATVYATGTHALVEDGRLLEQLMSSVGFCTEVEEDLIDAVTGLSGSGPAY
AFMALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLDSEQHPGQLKDNVCSPGGATIH
ALHFLESGGFRSLLINAVEASCIRTRELQSMAAQEKVSPAALKKTLLDRVKLESPTVSTL
THSSPGKLLTRSPGPGGKKD
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgggcttcatcggcgcgggccagctggcctgtgccctggcgcggggcttcacg
gcggcagggatcctgtcggctcacaagatcatagccagctccccggaaatggacctgccc
accgtgtcctcgctcaggaagatgggcgtgaacctgacccgaagcaacaaggagacggtg
aggcacagtgacgtcctgttcctggctgtgaagccgcacatcatccccttcatcctggac
gagatcggggccgacgtgcaggctaggcacatcgtggtgtcctgtgctgctggtgttacc
ataagctctgtggaaaagaagctgatggccttccagccggcccccaaggtgattcgctgc
atgaccaacacacccgtggtggtgcgggagggcgccacggtgtacgccacaggcacccac
gccctggtggaggacggcaggctcctggagcagctcatgagtagcgtgggcttctgcacg
gaggtggaagaggacctgattgacgccgtcacggggctcagtggcagtgggcctgcctac
gcattcatggccctggacgcgttggctgatggtggggtgaagatgggcctgcctcggcgc
ctggcggtccgcctgggggcccaggccttgctgggcgctgccaagatgctgctggactca
gagcagcacccaggccagctcaaggacaatgtctgctcccccgggggggccaccatccac
gccctgcacttcctggagagtgggggcttccgctccctgctcatcaacgccgtggaggcc
tcctgcatccgcacgcgggagctgcaatccatggctgcccaagagaaggtctcccctgct
gccctcaagaagaccctcctggacagagtgaagctggaatcccccacagtgtccacattg
acccattccagcccagggaagctgctcacaagaagcccaggccctgggggcaagaaggac
taa

DBGET integrated database retrieval system