KEGG   Odobenus rosmarus divergens (Pacific walrus): 101369234
Entry
101369234         CDS       T05148                                 

Gene name
MME
Definition
(RefSeq) neprilysin
  KO
K01389  neprilysin [EC:3.4.24.11]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04614  Renin-angiotensin system
oro04640  Hematopoietic cell lineage
oro04974  Protein digestion and absorption
oro05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:oro00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101369234 (MME)
  09152 Endocrine system
   04614 Renin-angiotensin system
    101369234 (MME)
  09154 Digestive system
   04974 Protein digestion and absorption
    101369234 (MME)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101369234 (MME)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:oro01002]
    101369234 (MME)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101369234 (MME)
   04090 CD molecules [BR:oro04090]
    101369234 (MME)
Enzymes [BR:oro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.11  neprilysin
     101369234 (MME)
Peptidases and inhibitors [BR:oro01002]
 Metallo peptidases
  Family M13: neprilysin family
   101369234 (MME)
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101369234 (MME)
CD molecules [BR:oro04090]
 Proteins
  101369234 (MME)
SSDB
Motif
Pfam: Peptidase_M13_N Peptidase_M13
Other DBs
NCBI-GeneID: 101369234
NCBI-ProteinID: XP_004405039
UniProt: A0A2U3W9P9
LinkDB
Position
Unknown
AA seq 749 aa
MGRSESQMDITDISTPRPKRQRWTPLEISLSVLVLLLTVIAVTMIALYATYDDGICKSSD
CIKSAARLIQNMDATAEPCTDFFKYACGGWLKRNVIPETSSRYSNFDILRDELEVILKDV
LQEPKPEDIVAVQKAKTLYRSCINESAIDSRGGKPLLSLLPDIYDWPVATENWEQTYGTS
WTAEKSIAQLNSKYGKKVILNFFVGTDDKNSVNHIIHIDQPRLGLPSRDYYECTGIYEEA
CTAYVDFMISVARLIRKEKGLPIDENQLSLEMKRVMELEKEIANATTKPEDRNDPMLLYN
KMTLAQIQNNFSLEIGGKPFSWSNFTNEIMSTVNINIPNEEDVVVYAPEYLTKLKLTLTK
YSARDLQNLMSWRFIMDLVSSLSRTYKESRNAFRKALYGTTSETATWRRCANYVNGNMEN
AVGRLYVEAAFAGESKHVVEDLITQIREVFIQTLDDLTWMDAETKKKAEEKALAIKERIG
YPDDIISNDNKLNNEYLELNYREDEYFENIIQNLKFSQNKQLKKLREKVDKDEWISGAAV
VNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKDG
DLVDWWTQQSANNFKDQSQCMVYQYGNFSWDLAGGQHLNGINTLGENIADNGGIGQAYRA
YQNYVKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRIIG
TLQNSPEFSEAFHCRKNSYMNPEKKCRVW
NT seq 2250 nt   +upstreamnt  +downstreamnt
atgggcagatcagaaagtcagatggatataactgatatcagcactccaaggccaaagaga
caacgatggaccccactggagatcagtctgtccgtccttgtcctcctccttaccgtcatc
gctgtgacgatgatcgcactctatgcgacctatgatgatggtatttgtaagtcgtcagac
tgcataaaatcagccgctcgactgatccagaacatggatgctactgctgagccttgtaca
gacttttttaaatatgcctgtggaggctggttgaaacgcaacgtcattcctgagaccagc
tcccgttacagtaactttgacattttaagagatgaactagaagtcattttgaaagatgtt
cttcaagaacccaaacctgaagatatagtagcagtgcagaaagcaaaaacattgtacaga
tcttgtataaatgaatctgccattgatagcagaggcgggaaacctctactcagtctgtta
ccagatatatatgattggccagtagcaacagaaaactgggagcaaacatatggtacttct
tggacggctgagaaatctattgcacaactgaattctaaatatgggaaaaaggtcattctt
aatttttttgttggcactgatgataagaactctgtgaaccatataattcatattgaccag
cctcggcttggcctcccttccagagactactatgagtgcactggaatatatgaagaggct
tgtacagcatatgtggattttatgatttctgtggccagattgattcgtaaggagaaagga
ctgcccatcgatgaaaaccagctttctttggaaatgaagagagttatggaattggaaaaa
gaaattgccaatgctacaactaaacctgaagatcgaaatgaccccatgcttctttacaac
aaaatgacattagcccagatccaaaataacttttcactagagatcggtggaaagccattc
agctggtcaaatttcacaaatgaaatcatgtcaactgtgaatattaatattccaaatgag
gaagatgtggttgtttatgctccagaatatttaaccaaacttaagctcactcttaccaaa
tattctgccagagatcttcaaaatttaatgtcctggcggttcataatggatcttgtaagc
agcctcagccgaacctacaaggagtccagaaatgctttccgcaaggccctatatggcaca
acatcagaaacagcaacatggagacgttgtgcaaactatgtcaatggaaatatggaaaat
gctgtgggaaggctgtacgtggaagcagcatttgctggagagagtaaacatgtggttgag
gatttgattacacaaatccgtgaggtttttattcagactttagatgacctcacttggatg
gatgctgaaacgaaaaagaaagctgaggagaaggccttagccattaaagaaagaattggc
tatcctgatgacattatttcaaatgataataaactgaataatgaatacctcgagttgaac
tacagggaagatgaatactttgagaacataattcaaaacttgaagttcagccaaaataaa
cagctaaagaagctccgagaaaaggtggacaaggatgagtggataagcggagcagctgta
gtcaatgcattttactcttcaggcagaaatcagatagtcttcccagctggcattctgcaa
ccccccttcttcagtgcccagcagtctaactcgttgaactacgggggtatcggcatggtc
ataggacatgaaatcacccatggcttcgatgacaatggcagaaattttaacaaggatgga
gaccttgttgactggtggactcaacagtcggcaaataattttaaagaccaatcccaatgc
atggtgtaccagtatggaaacttctcctgggacctagcaggtggacagcatctcaatgga
attaatacactgggagaaaatattgctgataatggaggtattggccaagcatacagagcc
tatcaaaattatgttaaaaagaatggtgaagaaaaattacttcctggacttgacctaaat
cacaaacaactattcttcttgaactttgcccaggtgtggtgtggcacctacaggccagag
tatgctgtcaactccattaaaacagatgttcacagtccagggaatttcaggattattggg
actttgcagaactcccctgagttttcagaggcctttcactgccgcaagaattcatacatg
aatccagaaaagaaatgccgcgtgtggtga

DBGET integrated database retrieval system