KEGG   Odobenus rosmarus divergens (Pacific walrus): 101369632Help
Entry
101369632         CDS       T05148                                 

Gene name
F13A1
Definition
(RefSeq) coagulation factor XIII A chain
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:oro00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    101369632 (F13A1)
Enzymes [BR:oro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101369632 (F13A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 101369632
NCBI-ProteinID: XP_004405703
UniProt: A0A2U3WBC2
LinkDB All DBs
Position
Unknown
AA seq 732 aa AA seqDB search
MSETSEPAFGGRRALPRNASNAAEDDLPTMELQGLVPRGVNLQDYLQVTDIHLFKERWDT
NKMDHHTDKYENNKLIVRRGQSFFIQINFNRPYDPRRDLFRVEYVIGRYPQENKGTYIPV
PVVPELQRGKWGAKVVMRGDRSVRLSIQSSPECIVGKFRMYVAVWTPYGILRTSRNPETD
TYILFNPWCEEDAVYLDDDKEREEYVLNDIGVIFYGDFNDIKSRSWSYGQFEDGILDACL
YVMDKAQMDLSGRANPIKVSRVGSAMVNAKDDEGVLVGSWDNIYAYGVPPSAWTGSVDIL
LEYQSTKNPVQYGQCWVFAGVFNTFLRCLGIPARVVTNYFSAHDNNANLQMDIFLEEDGN
VNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQVVDSTPQENSDGMYRCGPASVQAIKH
GHICFQFDAPFVFAEVNSDLVYITAKKDGTHVVETVDTSHIGKLIVTKEVGGDGIKDITD
TYKFQEGQEEERLALETALMYGAKKPLNTDGLLKTRSDVVMNFEVENAVLGRDFKLTITF
QNNNPNRYTLSAYLSGNIVFYTGVSKTEFKKETFEVMLEPMSFKKEEVLIRAGEYMGQLL
EQGYLHFFVTARVNETKDVLAKQKSTVLTIPQLIIKVRGTRMVGSDMVVTVEFTNPLKET
LRNVWIRLDGPGVMKPRRKMFREIQPNSTVQWEEVCRPWVSGRRKLIASMTSDSLRHVYG
ELDLQIQKRPSE
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagacctccgagcctgcatttggaggcaggagagccctgccccgcaacgcgtcc
aatgcggcagaggatgacctccccactatggagctgcaagggttggtgccccgaggtgtc
aacctgcaagactaccttcaggtcacagatattcacctgttcaaggagagatgggacacc
aataaaatggaccaccacactgacaagtatgaaaacaacaagttgattgtacgtagagga
cagtctttcttcatccagattaacttcaatcgtccatatgaccccagaagggatctcttc
agagtggaatatgtcattggtcgctaccctcaggagaacaagggaacctacattccagtt
cctgttgtcccggagctgcagagaggcaagtggggggccaaagttgtcatgagaggggac
aggtctgtccggctatccatccagtcttctccggagtgcattgtgggaaaattccgtatg
tatgttgctgtctggaccccctatggcatactccgcaccagccgaaacccagaaacggat
acgtacattctcttcaatccttggtgtgaagaggatgctgtatacctggatgatgataaa
gaaagagaagagtatgtcctgaatgacatcggggttattttttatggagacttcaatgac
atcaagagtagaagctggagttatggtcagtttgaggatggcatccttgacgcttgcctg
tatgtgatggacaaagcacaaatggacctttctggtagagcgaatcccatcaaagtcagc
cgtgttgggtctgcaatggttaatgccaaagatgatgaaggcgtccttgttggatcctgg
gacaatatctatgcctatggtgtccccccatcagcctggactggaagtgttgacattctg
ttggaataccagagtactaagaatccagtccagtatggtcaatgctgggtttttgctggt
gtctttaacacatttttgcgatgccttgggataccagcaagagtcgttactaattacttc
tcagcccatgataataatgccaatttgcaaatggacatcttcctggaagaagatgggaac
gtgaactccaaactcaccaaggattcagtgtggaactaccactgctggaatgaagcctgg
atgacaaggcctgatcttcccgttggatttggagggtggcaagttgtggacagcaccccc
caagaaaacagtgatgggatgtatcggtgcggcccagcctccgttcaagctattaagcac
ggccatatttgcttccagtttgacgcaccctttgtttttgcggaggtcaacagtgatctc
gtttacattacagccaagaaagatggcactcatgtggttgaaaccgttgataccagccac
attgggaaattgattgtaaccaaagaagttggaggcgatggcataaaggatattactgat
acctacaaattccaagaaggccaagaagaagagaggctggccctggaaactgccctgatg
tatggggctaaaaagcccctcaacacggatggcctccttaaaaccaggtctgacgtggtc
atgaattttgaagtggaaaatgctgtgctgggaagagacttcaagctaaccatcaccttc
cagaacaacaaccccaaccgttacaccctctcagcctatctctcgggcaatattgtcttc
tacacgggggtctccaagacagaattcaagaaggagacattcgaagtgatgctggagccc
atgtctttcaagaaagaagaggtgctgatccgagcgggtgagtacatgggccagctgctg
gaacaagggtacctgcatttctttgtcacagcacgtgtcaacgagaccaaggatgttctg
gccaagcagaagtccactgtgctgaccatcccccagctcatcatcaaggtccgcggcacc
aggatggttggttctgacatggtggtgacagttgagtttaccaatcctctaaaagaaact
ctgcggaatgtgtggatacgcctggatggccctggagtgatgaagccaaggaggaagatg
ttccgtgaaatccagcccaactccaccgtgcaatgggaagaagtgtgtcgaccctgggtg
tctggccgtcggaagctgatagccagcatgaccagtgactcgctgagacacgtgtatggc
gagctggatttgcagattcaaaaacgaccttctgaataa

DBGET integrated database retrieval system