KEGG   Odobenus rosmarus divergens (Pacific walrus): 101369639
Entry
101369639         CDS       T05148                                 

Gene name
ITGA2B
Definition
(RefSeq) integrin alpha-IIb isoform X1
  KO
K06476  integrin alpha 2B
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04015  Rap1 signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04510  Focal adhesion
oro04512  ECM-receptor interaction
oro04611  Platelet activation
oro04613  Neutrophil extracellular trap formation
oro04640  Hematopoietic cell lineage
oro04810  Regulation of actin cytoskeleton
oro05165  Human papillomavirus infection
oro05200  Pathways in cancer
oro05222  Small cell lung cancer
oro05410  Hypertrophic cardiomyopathy
oro05412  Arrhythmogenic right ventricular cardiomyopathy
oro05414  Dilated cardiomyopathy
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101369639 (ITGA2B)
   04151 PI3K-Akt signaling pathway
    101369639 (ITGA2B)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101369639 (ITGA2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101369639 (ITGA2B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101369639 (ITGA2B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101369639 (ITGA2B)
   04611 Platelet activation
    101369639 (ITGA2B)
   04613 Neutrophil extracellular trap formation
    101369639 (ITGA2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101369639 (ITGA2B)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101369639 (ITGA2B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101369639 (ITGA2B)
   05410 Hypertrophic cardiomyopathy
    101369639 (ITGA2B)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101369639 (ITGA2B)
   05414 Dilated cardiomyopathy
    101369639 (ITGA2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101369639 (ITGA2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oro01009]
    101369639 (ITGA2B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101369639 (ITGA2B)
   04515 Cell adhesion molecules [BR:oro04515]
    101369639 (ITGA2B)
   04090 CD molecules [BR:oro04090]
    101369639 (ITGA2B)
Protein phosphatases and associated proteins [BR:oro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101369639 (ITGA2B)
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101369639 (ITGA2B)
Cell adhesion molecules [BR:oro04515]
 Integrins
  Integrin alpha subunits
   101369639 (ITGA2B)
CD molecules [BR:oro04090]
 Proteins
  101369639 (ITGA2B)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Other DBs
NCBI-GeneID: 101369639
NCBI-ProteinID: XP_004407312
UniProt: A0A2U3WFA0
LinkDB
Position
Unknown
AA seq 1036 aa
MARAVCPLHALWLLEWVQLLLGPGPIPPAWALNLDPVQLTLYTGPNGSHFGFSLDFYKDN
HGRVAIVAGAPRTLGPSQEETGGVFLCPWRAEGSQCTLLTFDLNDETRHVGSHTFQTFKS
RQGLGASVVSWNDNIVACAPWQHWNALEKTEEAEKTPVGGCFVAQLQNGHRAEYSPCRAN
TMSQVYVKNGFIDDRRYCEAGFSSVVTQAGELVLGAPGGYFFLGLLARAPITSIVSSYRP
GTLLWHVPNQSFTLDNSKPEYYDGYRGYSVAVGEFDGDLSTTEYVLGAPTWSWTLGAVEI
LNSSHQTLHKLHGEQMASYFGHSVTVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVY
LFLQPRGHHVLGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQV
LVFLGQSEGLSSRPSQILDSPFPAGSGFGFSLRGATDIDDNGYPDLLVGAYGANKVAVYR
AQPVVMANVQLLVQDSLNPAVKNCVLPQTQTRVTCFNIQMCVGATGHNIPQQLPLNAELQ
LDRQKPRQGRRVLLLNSQLSGTTLHLDLGGRHSPICHTTMAFLRDEADFRDKLSPIVLSF
NVSLQPRKDGVAPAVVLHGDTHVQEQTRIILDCGEDDLCVPQLQLTANVMGSPLLIGADN
VLELQMDAANEGEGAYEAELAVHLPLGAHYMRAISNIEGFERLICNQKKENETKMVLCEL
GNPMKRNARIGITMLVSVENLEEAGERVSFWLQIRSKNSQNPNSEAVLLDVPVRAEAHVE
LRGNSFPASLVVVAEEDNRENSSDIWGPKVEHTYELHNNGPGTVSGLRLCLCLPGQSQPS
DLLYILDIQPQGGLQCSPQPTPNPYKLNWRLPTPSPSATSPGHHKRERRQASLSGSNQPV
RLQDPVLLSCDSGPYTVVQCELQEMERGQRAMVRVLAFLQLPGLQQRPLDQFVLQSQAWF
NVSSLPYAVPALSLPSGETLVQTHLLRALEERDIPIWWVLVGVLGGLVLLTLLVLAMWKV
GFFKRNRPPLEEDEEE
NT seq 3111 nt   +upstreamnt  +downstreamnt
atggccagagctgtgtgtccacttcatgccctctggcttctggagtgggtgcagctgctc
ttgggacctggtcccatccctccagcctgggccttgaacctggacccagtgcaactcacc
ttgtacacgggccccaatggcagccactttgggttttcactggacttctacaaggacaac
catgggagagtggccatcgtggcgggcgccccgcggaccctgggccccagccaggaggag
acaggcggcgtgttcctgtgcccctggagggccgagggcagccagtgcaccttgctaacc
ttcgacctcaatgatgagacccgacacgtaggctcccacaccttccaaaccttcaagtcc
cggcaaggactgggggcgtcggtcgtcagctggaacgacaacattgtggcctgcgccccc
tggcagcactggaacgccctagaaaagaccgaagaagctgagaagacgcccgtaggtggc
tgcttcgtggctcagctacagaacggccaccgcgcagagtactcgccctgtcgggctaac
accatgagccaggtttacgtgaaaaacggctttatagacgaccggcgctactgcgaagcg
ggcttcagctccgtggttactcaggctggagagctggtgcttggggcccctggcggctat
tttttcttaggtctcctggcgcgggctcccattaccagtatcgtctcgagttaccgccca
ggcaccctcttgtggcacgtgcccaaccagagcttcaccttagacaacagcaagccagag
tactacgacggctaccgggggtactcggtggccgtgggagagttcgacggggatctcagt
actacagaatatgtcctcggtgcccccacctggagctggaccctgggagcggtggaaatt
ttgaactcgtcccaccagacgctgcacaagctgcatggagagcagatggcttcgtatttt
ggacactcagtgaccgtcactgatgtcaacggagacgggaggcacgacctgctggtgggc
gcgccactgtacatggagagccgcgctgaccgcaagctggccgaggtggggcgcgtgtac
ttgttcctgcagcctcgaggtcaccacgtgctgggcgcccccagcctcctgctgaccggc
acacagctctacgggcgattcggctcggccatcgcacctctgggcgacctcgaccgggat
ggctacaacgatattgcagtggccgccccatacggaggtcccagtggtcggggccaagtg
ctggtgttcctggggcagagcgaggggctgagctcacgcccctcccagatcctggacagc
cccttcccggcaggctctggcttcggcttctccctgcgaggtgccacagacatcgatgac
aatggatacccagacctcctggtgggagcttatggggccaacaaggtggctgtgtacaga
gctcagccagtggtgatggccaatgtccagctgctggtacaagattcactgaatcctgct
gtgaagaattgtgtcctgccccagacccagacgcgcgtgacctgctttaacatacagatg
tgtgtaggagccactgggcacaacattcctcagcagctgcccctaaacgccgagctgcag
ctggaccggcagaagccccgccagggccggcgggtgctactgctgaattcgcaattgtca
ggcaccacgctgcatctggacctgggcgggaggcacagccccatctgccacaccaccatg
gctttcctccgagacgaggccgacttccgggacaagctgagccccattgtgctcagcttc
aatgtgtccttgcaacccaggaaggatggagtagcccctgctgtcgtgcttcatggagac
acccatgtccaggagcagacccgaatcatcctggactgtggggaagatgacctgtgcgtg
ccccagctccagctcaccgccaacgtgatgggctcccccctcctcattggagccgataat
gtgctggagctgcagatggatgcagccaacgagggcgagggggcctacgaagcagagctg
gccgtgcacctgcccctaggcgcccactacatgcgggccatcagcaacatcgagggcttt
gagagactcatctgtaaccagaagaaggagaatgagaccaagatggtgctgtgtgagctg
ggcaaccccatgaagaggaatgcccggataggaatcacaatgttggtgagtgtggagaac
ctggaagaggctggggagcgtgtgtccttctggctacagatcagaagcaagaacagccag
aatccgaacagtgaggctgtgctgctggatgtcccagtccgggcagaggcccatgtggag
ctgcgagggaactcctttccagcctccctggtggtggtggctgaagaagacaacagggag
aacagctccgacatctggggccccaaagtggagcacacctatgagctccacaacaatggc
cctggcactgtaagtggcctccgcctctgcctctgcctccctggccagtcccagccttct
gacctgctctacatcctggacatacagccccagggggggcttcagtgctccccccagccc
actcctaacccctacaagctgaactggaggctgccgacccccagtccctccgccacctcc
cccgggcatcacaagcgggagcgcagacaggcgtccctgtcagggtccaaccagccggtc
aggcttcaggatccagttctcctgagctgtgactcggggccgtacacggtggtgcagtgt
gagctgcaggagatggagcgaggccagcgggccatggtcagggtgctggccttcctgcag
ctgcccggcctccagcagaggccactggatcagttcgtgctgcagtcgcaagcttggttc
aacgtctcctcccttccctacgccgtgcccgccctcagcctgcccagtggggaaactctg
gtgcagacgcacctgcttcgagccttggaggaaagggacattcccatctggtgggtgctg
gtaggcgtgctcggcggcctggtgttgctcacgctcctggtcctggccatgtggaaggtc
ggcttcttcaagcgcaaccggccgccactagaagaagatgaggaggagtag

DBGET integrated database retrieval system