KEGG   Odobenus rosmarus divergens (Pacific walrus): 101369957
Entry
101369957         CDS       T05148                                 

Gene name
ITGB3
Definition
(RefSeq) integrin beta-3
  KO
K06493  integrin beta 3
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04015  Rap1 signaling pathway
oro04145  Phagosome
oro04151  PI3K-Akt signaling pathway
oro04380  Osteoclast differentiation
oro04510  Focal adhesion
oro04512  ECM-receptor interaction
oro04611  Platelet activation
oro04613  Neutrophil extracellular trap formation
oro04640  Hematopoietic cell lineage
oro04810  Regulation of actin cytoskeleton
oro04919  Thyroid hormone signaling pathway
oro05163  Human cytomegalovirus infection
oro05165  Human papillomavirus infection
oro05168  Herpes simplex virus 1 infection
oro05205  Proteoglycans in cancer
oro05206  MicroRNAs in cancer
oro05410  Hypertrophic cardiomyopathy
oro05412  Arrhythmogenic right ventricular cardiomyopathy
oro05414  Dilated cardiomyopathy
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101369957 (ITGB3)
   04151 PI3K-Akt signaling pathway
    101369957 (ITGB3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101369957 (ITGB3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101369957 (ITGB3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101369957 (ITGB3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101369957 (ITGB3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101369957 (ITGB3)
   04611 Platelet activation
    101369957 (ITGB3)
   04613 Neutrophil extracellular trap formation
    101369957 (ITGB3)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101369957 (ITGB3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101369957 (ITGB3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    101369957 (ITGB3)
   05205 Proteoglycans in cancer
    101369957 (ITGB3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101369957 (ITGB3)
   05410 Hypertrophic cardiomyopathy
    101369957 (ITGB3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101369957 (ITGB3)
   05414 Dilated cardiomyopathy
    101369957 (ITGB3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101369957 (ITGB3)
   05163 Human cytomegalovirus infection
    101369957 (ITGB3)
   05165 Human papillomavirus infection
    101369957 (ITGB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oro04131]
    101369957 (ITGB3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101369957 (ITGB3)
   04515 Cell adhesion molecules [BR:oro04515]
    101369957 (ITGB3)
   04090 CD molecules [BR:oro04090]
    101369957 (ITGB3)
Membrane trafficking [BR:oro04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    101369957 (ITGB3)
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101369957 (ITGB3)
Cell adhesion molecules [BR:oro04515]
 Integrins
  Integrin beta subunits
   101369957 (ITGB3)
CD molecules [BR:oro04090]
 Proteins
  101369957 (ITGB3)
SSDB
Motif
Pfam: Integrin_beta Integrin_B_tail Integrin_b_cyt I-EGF_1 PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 101369957
NCBI-ProteinID: XP_004411143
UniProt: A0A2U3WPP4
LinkDB
Position
Unknown
AA seq 784 aa
MRARPLWAAVLVLGALAGGGGGVSNICTTRGVRSCQQCLAVSPVCAWCSDEALPLGTPRC
NLKENLLKDNCALESIEFPISEAHILEARPLSDKGSGDSYQITQVSPQRIALRLRPDDSK
NFSIQVRQVEDYPVDIYYLMDLSYSMKDDLSSIQNLGTKLASQMHKLTSNLRIGFGAFVD
KPVSPYMYISPPEALKNPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDA
PEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSD
NHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTANVVNLYQNYSELIPGTTVGILSTDSS
NVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCVGLKIGDTVSFS
IEAKVRGCPQEKEKSFTIKPVGFKDSLTVQVTFDCDCECQAQAETSSDRCNHGNGTFECG
VCLCGPGWLGSQCECSEEDYRPSQQDECSPQEGQPACSQRGECLCGQCVCHSSDFGKITG
KYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGR
GKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHEDNTCNRYCRDE
IESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDILVVLL
SVMGAILLIGLATLLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNIT
YRGT
NT seq 2355 nt   +upstreamnt  +downstreamnt
atgcgggcgcggccgctgtgggccgcggtgctggtgctgggggcgctggcgggcggcggc
ggcggagtgtccaacatctgtaccacacgaggtgtccgctcctgccagcaatgtctggct
gtgagtcccgtgtgtgcctggtgctcagatgaggccctgcctctgggcactccccgctgt
aatctgaaggagaatctgctgaaggataactgtgccttggagtccatcgagttccccatc
agtgaggcccacatcctggaggccagacccctcagcgacaagggctctggagacagctac
cagattactcaagtcagccctcagaggattgcactccggctacggccagatgattcaaag
aatttctccatccaagtccggcaagtggaggattaccctgtggacatctactacttgatg
gacctgtcttactccatgaaggatgatctgtcgagtatccagaacctaggcaccaagctg
gcctcccagatgcacaagctcaccagtaacttgcggattggctttggggctttcgtggac
aagcccgtgtcaccatacatgtacatctccccaccagaggccctcaaaaacccctgctat
gatatgaagaccacctgtttgcctatgtttggctacaaacatgtgctgacgctaactgac
caggtgacccgcttcaatgaagaagtgaagaagcagagtgtgtcgcggaaccgggatgcc
ccagagggtggctttgatgccatcatgcaggctacagtctgtgatgagaagattggctgg
aggaacgatgcatcccacttgctggtgtttaccactgatgccaagacccatatagcgctg
gatggaaggctggcaggcattgtccagcccaatgatgggcagtgtcacgttggcagtgac
aaccattactctgcctccactaccatggattatccctctctggggctgatgaccgagaag
ctatcccagaaaaacatcaatttgatctttgcagtaactgcaaatgtagtcaatctctac
cagaactacagtgagctcatcccagggaccacagtggggattctgtctaccgattccagc
aatgtccttcagctcatcgttgatgcatatggaaaaatccgctctaaagtagagctggaa
gtgcgtgacctccctgaggagttgtctctgtccttcaacgccacctgtctcaacaacgag
gtcatcccaggcctcaagtcttgtgtcggactcaagattggagacacggtgagcttcagc
attgaggccaaggtgcgtggctgcccacaggagaaggagaagtccttcaccatcaagcct
gtaggcttcaaagacagcctcacggtccaggtcacctttgactgtgactgtgaatgccag
gcccaggccgagacttccagcgaccgctgcaaccatggcaatgggacgtttgagtgcggg
gtgtgcctctgcgggcctggctggctggggtcccagtgtgagtgctcggaggaggactac
cgcccctcccagcaggacgagtgcagcccccaggagggccagcccgcctgtagccagcgg
ggcgagtgcctgtgcggccagtgcgtctgccacagcagcgactttggcaagatcacgggc
aagtactgcgagtgtgatgacttctcctgtgtccgctacaagggggaaatgtgctcgggc
catggacagtgcagctgtggggactgcctgtgtgactcggactggactggctactactgc
aactgcactacgcgcacggacacctgcatgtccagcaatgggttgctgtgcagcggccgt
ggcaagtgtgagtgtggcagctgcgtgtgcatccagcccggctcctacggggacacctgc
gagaagtgccccacctgccccgatgcctgcacctttaagaaggagtgtgtggagtgcaag
aaatttgaccgaggagccctccatgaggacaatacctgcaaccgttactgtcgtgatgag
atcgagtctgtgaaggaacttaaggatactgggaaggatgcagtgaattgtacatacaag
aatgaggatgactgtgtcgtcagattccagtactatgaagactcgagtggaaagtccatt
ctctatgtggtagaagagccagagtgtcccaagggtcctgacatcctggtggtcctgctt
tcagtgatgggggccattttgctcatcggccttgctactctgctcatctggaagctcctc
atcaccatccatgaccggaaggagtttgctaaatttgaggaagagagagccagagcaaaa
tgggacacagccaacaacccactgtacaaagaggccacatccaccttcaccaatatcacc
taccggggcacttaa

DBGET integrated database retrieval system