KEGG   Odobenus rosmarus divergens (Pacific walrus): 101370100
Entry
101370100         CDS       T05148                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01521  EGFR tyrosine kinase inhibitor resistance
oro01522  Endocrine resistance
oro01524  Platinum drug resistance
oro04012  ErbB signaling pathway
oro04014  Ras signaling pathway
oro04015  Rap1 signaling pathway
oro04024  cAMP signaling pathway
oro04062  Chemokine signaling pathway
oro04066  HIF-1 signaling pathway
oro04068  FoxO signaling pathway
oro04070  Phosphatidylinositol signaling system
oro04071  Sphingolipid signaling pathway
oro04072  Phospholipase D signaling pathway
oro04140  Autophagy - animal
oro04150  mTOR signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04152  AMPK signaling pathway
oro04210  Apoptosis
oro04211  Longevity regulating pathway
oro04213  Longevity regulating pathway - multiple species
oro04218  Cellular senescence
oro04360  Axon guidance
oro04370  VEGF signaling pathway
oro04380  Osteoclast differentiation
oro04510  Focal adhesion
oro04550  Signaling pathways regulating pluripotency of stem cells
oro04611  Platelet activation
oro04613  Neutrophil extracellular trap formation
oro04620  Toll-like receptor signaling pathway
oro04625  C-type lectin receptor signaling pathway
oro04630  JAK-STAT signaling pathway
oro04650  Natural killer cell mediated cytotoxicity
oro04660  T cell receptor signaling pathway
oro04662  B cell receptor signaling pathway
oro04664  Fc epsilon RI signaling pathway
oro04666  Fc gamma R-mediated phagocytosis
oro04668  TNF signaling pathway
oro04670  Leukocyte transendothelial migration
oro04722  Neurotrophin signaling pathway
oro04725  Cholinergic synapse
oro04750  Inflammatory mediator regulation of TRP channels
oro04810  Regulation of actin cytoskeleton
oro04910  Insulin signaling pathway
oro04914  Progesterone-mediated oocyte maturation
oro04915  Estrogen signaling pathway
oro04917  Prolactin signaling pathway
oro04919  Thyroid hormone signaling pathway
oro04923  Regulation of lipolysis in adipocytes
oro04926  Relaxin signaling pathway
oro04929  GnRH secretion
oro04930  Type II diabetes mellitus
oro04931  Insulin resistance
oro04932  Non-alcoholic fatty liver disease
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro04935  Growth hormone synthesis, secretion and action
oro04960  Aldosterone-regulated sodium reabsorption
oro04973  Carbohydrate digestion and absorption
oro05010  Alzheimer disease
oro05017  Spinocerebellar ataxia
oro05020  Prion disease
oro05100  Bacterial invasion of epithelial cells
oro05135  Yersinia infection
oro05142  Chagas disease
oro05146  Amoebiasis
oro05160  Hepatitis C
oro05161  Hepatitis B
oro05162  Measles
oro05163  Human cytomegalovirus infection
oro05164  Influenza A
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05168  Herpes simplex virus 1 infection
oro05169  Epstein-Barr virus infection
oro05170  Human immunodeficiency virus 1 infection
oro05171  Coronavirus disease - COVID-19
oro05200  Pathways in cancer
oro05203  Viral carcinogenesis
oro05205  Proteoglycans in cancer
oro05206  MicroRNAs in cancer
oro05210  Colorectal cancer
oro05211  Renal cell carcinoma
oro05212  Pancreatic cancer
oro05213  Endometrial cancer
oro05214  Glioma
oro05215  Prostate cancer
oro05218  Melanoma
oro05220  Chronic myeloid leukemia
oro05221  Acute myeloid leukemia
oro05222  Small cell lung cancer
oro05223  Non-small cell lung cancer
oro05224  Breast cancer
oro05225  Hepatocellular carcinoma
oro05226  Gastric cancer
oro05230  Central carbon metabolism in cancer
oro05231  Choline metabolism in cancer
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101370100 (PIK3R1)
   04014 Ras signaling pathway
    101370100 (PIK3R1)
   04015 Rap1 signaling pathway
    101370100 (PIK3R1)
   04370 VEGF signaling pathway
    101370100 (PIK3R1)
   04630 JAK-STAT signaling pathway
    101370100 (PIK3R1)
   04668 TNF signaling pathway
    101370100 (PIK3R1)
   04066 HIF-1 signaling pathway
    101370100 (PIK3R1)
   04068 FoxO signaling pathway
    101370100 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    101370100 (PIK3R1)
   04072 Phospholipase D signaling pathway
    101370100 (PIK3R1)
   04071 Sphingolipid signaling pathway
    101370100 (PIK3R1)
   04024 cAMP signaling pathway
    101370100 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    101370100 (PIK3R1)
   04152 AMPK signaling pathway
    101370100 (PIK3R1)
   04150 mTOR signaling pathway
    101370100 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101370100 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    101370100 (PIK3R1)
   04218 Cellular senescence
    101370100 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101370100 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    101370100 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101370100 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101370100 (PIK3R1)
   04613 Neutrophil extracellular trap formation
    101370100 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    101370100 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    101370100 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    101370100 (PIK3R1)
   04660 T cell receptor signaling pathway
    101370100 (PIK3R1)
   04662 B cell receptor signaling pathway
    101370100 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    101370100 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    101370100 (PIK3R1)
   04670 Leukocyte transendothelial migration
    101370100 (PIK3R1)
   04062 Chemokine signaling pathway
    101370100 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101370100 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    101370100 (PIK3R1)
   04929 GnRH secretion
    101370100 (PIK3R1)
   04915 Estrogen signaling pathway
    101370100 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    101370100 (PIK3R1)
   04917 Prolactin signaling pathway
    101370100 (PIK3R1)
   04926 Relaxin signaling pathway
    101370100 (PIK3R1)
   04935 Growth hormone synthesis, secretion and action
    101370100 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    101370100 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101370100 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101370100 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    101370100 (PIK3R1)
   04722 Neurotrophin signaling pathway
    101370100 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101370100 (PIK3R1)
  09158 Development and regeneration
   04360 Axon guidance
    101370100 (PIK3R1)
   04380 Osteoclast differentiation
    101370100 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    101370100 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    101370100 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101370100 (PIK3R1)
   05206 MicroRNAs in cancer
    101370100 (PIK3R1)
   05205 Proteoglycans in cancer
    101370100 (PIK3R1)
   05203 Viral carcinogenesis
    101370100 (PIK3R1)
   05230 Central carbon metabolism in cancer
    101370100 (PIK3R1)
   05231 Choline metabolism in cancer
    101370100 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101370100 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101370100 (PIK3R1)
   05212 Pancreatic cancer
    101370100 (PIK3R1)
   05225 Hepatocellular carcinoma
    101370100 (PIK3R1)
   05226 Gastric cancer
    101370100 (PIK3R1)
   05214 Glioma
    101370100 (PIK3R1)
   05221 Acute myeloid leukemia
    101370100 (PIK3R1)
   05220 Chronic myeloid leukemia
    101370100 (PIK3R1)
   05218 Melanoma
    101370100 (PIK3R1)
   05211 Renal cell carcinoma
    101370100 (PIK3R1)
   05215 Prostate cancer
    101370100 (PIK3R1)
   05213 Endometrial cancer
    101370100 (PIK3R1)
   05224 Breast cancer
    101370100 (PIK3R1)
   05222 Small cell lung cancer
    101370100 (PIK3R1)
   05223 Non-small cell lung cancer
    101370100 (PIK3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101370100 (PIK3R1)
   05017 Spinocerebellar ataxia
    101370100 (PIK3R1)
   05020 Prion disease
    101370100 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101370100 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101370100 (PIK3R1)
   04932 Non-alcoholic fatty liver disease
    101370100 (PIK3R1)
   04931 Insulin resistance
    101370100 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101370100 (PIK3R1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101370100 (PIK3R1)
   05100 Bacterial invasion of epithelial cells
    101370100 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101370100 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    101370100 (PIK3R1)
   05161 Hepatitis B
    101370100 (PIK3R1)
   05160 Hepatitis C
    101370100 (PIK3R1)
   05171 Coronavirus disease - COVID-19
    101370100 (PIK3R1)
   05164 Influenza A
    101370100 (PIK3R1)
   05162 Measles
    101370100 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    101370100 (PIK3R1)
   05163 Human cytomegalovirus infection
    101370100 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101370100 (PIK3R1)
   05169 Epstein-Barr virus infection
    101370100 (PIK3R1)
   05165 Human papillomavirus infection
    101370100 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101370100 (PIK3R1)
   05142 Chagas disease
    101370100 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101370100 (PIK3R1)
   01524 Platinum drug resistance
    101370100 (PIK3R1)
   01522 Endocrine resistance
    101370100 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oro04131]
    101370100 (PIK3R1)
Membrane trafficking [BR:oro04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101370100 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 AAA_13 DUF4201 SH3_2 Laminin_I Mod_r Lant_dehydr_C PI_PP_I FNIP_M
Other DBs
NCBI-GeneID: 101370100
NCBI-ProteinID: XP_004416099
UniProt: A0A2U3X1Z3
LinkDB
Position
Unknown
AA seq 725 aa
MSAEGYQYRALYDYKKERDEDIDLHLGDVLTVNKGSLVALGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKAEADGEQQQALALPDLA
EQFAPPDIAPPLLMKLVEAIEKKGLECSTLYRTQSSSNPAELRQLLDCDAASMDLEMIDV
QVLGDAFKRYLVDLPNPVIPVAVYNEMIYLAQEVQSSEEYIQLLKKLIRAPNIPHQYWLT
LQYLLKHFFKLSQTSSKNLLSARVLSELFSPLLFRFPAASSENTEHLIKVIEILISTEWN
ERQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRD
ASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPK
LDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNAQFQEKSREYDRLYEDYTRTSQEIQM
KRTAIEAFNETIKIFEEQCQSQERYSKEYIEKFKREGNEKEIQRIMHNYEKLKSRISEIV
DSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLG
NENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYAC
SVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVY
AQQRR
NT seq 2178 nt   +upstreamnt  +downstreamnt
atgagtgccgagggctatcagtaccgagcgctgtatgattacaaaaaggaacgagacgaa
gatattgacttgcacttgggtgatgtcttgactgtgaataaagggtccttagtagctctt
ggattcagtgatggacaggaagccaggcctgaagaaatcggctggttaaatggttataat
gaaaccacgggggaaagaggggactttccgggaacttacgttgaatatattggaaggaaa
aaaatctcgcctcccacgccaaagccccgaccacctcgaccccttcctgttgcaccaggt
tcttcgaaagctgaagcagacggtgagcaacagcaagctttggcccttccagatctcgcc
gagcagtttgcccctcccgacattgctccgcctcttctcatgaagctagtggaagccatt
gaaaagaaaggtctggaatgttcaactctatacagaacacagagctccagcaacccagca
gaattacgacagcttcttgattgtgatgccgcctccatggacttggaaatgatcgatgtg
caagttttaggagacgctttcaaacgctatcttgtggacttaccgaatcctgtcattcca
gtagccgtttacaatgaaatgatttatttagcccaagaagtacagagctctgaagaatat
atccagctgttgaagaagctcattagggcacctaacatacctcatcagtattggcttacg
cttcagtatttgctaaaacatttcttcaagctctctcaaacctccagcaagaatcttctg
agtgcaagagtactctctgaacttttcagccctctgcttttcagattcccagcagccagc
tctgagaatactgaacacctcataaaagttatagaaattttaatctcaactgagtggaat
gaacgacagcctgcaccagcattgcctcctaaaccaccaaaacccactactgtagccaac
aacggtatgaataacaatatgtccttacaagatgctgaatggtactggggagatatctca
agggaagaagtgaatgaaaaacttcgagacacagctgacgggaccttcttggtacgagac
gcatctacgaaaatgcacggtgattatactcttacactaaggaaaggaggaaataacaaa
ttaatcaaaatatttcacagagatgggaaatatggcttctctgacccactgacgttcaac
tccgtggttgaactaataaaccactaccggaacgagtccctagctcagtataatcccaaa
ctggacgtgaagttactttatccagtatccaaataccaacaggatcaagttgtcaaagaa
gataatattgaagctgtaggaaagaagttacatgaatataacgctcaatttcaagaaaaa
agtcgggaatatgatagattatatgaagattatacccgtacttcccaggaaatccaaatg
aaaagaacagctattgaagcctttaatgaaaccataaagatatttgaagaacagtgccaa
agtcaggaacggtacagcaaagaatacatagaaaaatttaaacgtgaaggcaatgagaaa
gagatacaaaggattatgcataattatgagaagttaaagtcccgaatcagtgaaattgtg
gacagtcgaagaagactggaggaagacttgaagaagcaggcagctgagtaccgggagatt
gacaaacgcatgaacagcattaaaccagacctcattcagctgagaaagacaagagaccaa
tacttgatgtggttgactcagaaaggtgttcggcagaagaagctgaatgagtggttgggc
aatgaaaatacggaagaccaatattcgctggtggaagacgatgaggatttgccgcaccac
gacgagaagacctggaatgtgggcagcagcaacagaaacaaagctgagaacctactccga
gggaaacgagacggcaccttcctggtccgggagagcagcaaacagggctgctacgcctgc
tccgtagtggtggacggcgaagtcaagcactgtgtcatcaacaaaacggccactggctat
ggcttcgccgagccctataacctgtacagttccctgaaggaactggtgctccactaccag
cacacgtccctcgtgcagcacaatgactcgctcaacgtcaccctggcctacccggtgtac
gcgcagcagagacgatga

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101370689
Entry
101370689         CDS       T05148                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00562  Inositol phosphate metabolism
oro01100  Metabolic pathways
oro01521  EGFR tyrosine kinase inhibitor resistance
oro01522  Endocrine resistance
oro01524  Platinum drug resistance
oro04012  ErbB signaling pathway
oro04014  Ras signaling pathway
oro04015  Rap1 signaling pathway
oro04024  cAMP signaling pathway
oro04062  Chemokine signaling pathway
oro04066  HIF-1 signaling pathway
oro04068  FoxO signaling pathway
oro04070  Phosphatidylinositol signaling system
oro04071  Sphingolipid signaling pathway
oro04072  Phospholipase D signaling pathway
oro04140  Autophagy - animal
oro04150  mTOR signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04152  AMPK signaling pathway
oro04210  Apoptosis
oro04211  Longevity regulating pathway
oro04213  Longevity regulating pathway - multiple species
oro04218  Cellular senescence
oro04360  Axon guidance
oro04370  VEGF signaling pathway
oro04380  Osteoclast differentiation
oro04510  Focal adhesion
oro04550  Signaling pathways regulating pluripotency of stem cells
oro04611  Platelet activation
oro04613  Neutrophil extracellular trap formation
oro04620  Toll-like receptor signaling pathway
oro04625  C-type lectin receptor signaling pathway
oro04630  JAK-STAT signaling pathway
oro04650  Natural killer cell mediated cytotoxicity
oro04660  T cell receptor signaling pathway
oro04662  B cell receptor signaling pathway
oro04664  Fc epsilon RI signaling pathway
oro04666  Fc gamma R-mediated phagocytosis
oro04668  TNF signaling pathway
oro04670  Leukocyte transendothelial migration
oro04722  Neurotrophin signaling pathway
oro04725  Cholinergic synapse
oro04750  Inflammatory mediator regulation of TRP channels
oro04810  Regulation of actin cytoskeleton
oro04910  Insulin signaling pathway
oro04914  Progesterone-mediated oocyte maturation
oro04915  Estrogen signaling pathway
oro04917  Prolactin signaling pathway
oro04919  Thyroid hormone signaling pathway
oro04923  Regulation of lipolysis in adipocytes
oro04926  Relaxin signaling pathway
oro04929  GnRH secretion
oro04930  Type II diabetes mellitus
oro04931  Insulin resistance
oro04932  Non-alcoholic fatty liver disease
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro04935  Growth hormone synthesis, secretion and action
oro04960  Aldosterone-regulated sodium reabsorption
oro04973  Carbohydrate digestion and absorption
oro05010  Alzheimer disease
oro05017  Spinocerebellar ataxia
oro05020  Prion disease
oro05100  Bacterial invasion of epithelial cells
oro05132  Salmonella infection
oro05135  Yersinia infection
oro05142  Chagas disease
oro05146  Amoebiasis
oro05160  Hepatitis C
oro05161  Hepatitis B
oro05162  Measles
oro05163  Human cytomegalovirus infection
oro05164  Influenza A
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05168  Herpes simplex virus 1 infection
oro05169  Epstein-Barr virus infection
oro05170  Human immunodeficiency virus 1 infection
oro05171  Coronavirus disease - COVID-19
oro05200  Pathways in cancer
oro05203  Viral carcinogenesis
oro05205  Proteoglycans in cancer
oro05206  MicroRNAs in cancer
oro05210  Colorectal cancer
oro05211  Renal cell carcinoma
oro05212  Pancreatic cancer
oro05213  Endometrial cancer
oro05214  Glioma
oro05215  Prostate cancer
oro05218  Melanoma
oro05220  Chronic myeloid leukemia
oro05221  Acute myeloid leukemia
oro05222  Small cell lung cancer
oro05223  Non-small cell lung cancer
oro05224  Breast cancer
oro05225  Hepatocellular carcinoma
oro05226  Gastric cancer
oro05230  Central carbon metabolism in cancer
oro05231  Choline metabolism in cancer
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101370689 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101370689 (PIK3CA)
   04014 Ras signaling pathway
    101370689 (PIK3CA)
   04015 Rap1 signaling pathway
    101370689 (PIK3CA)
   04370 VEGF signaling pathway
    101370689 (PIK3CA)
   04630 JAK-STAT signaling pathway
    101370689 (PIK3CA)
   04668 TNF signaling pathway
    101370689 (PIK3CA)
   04066 HIF-1 signaling pathway
    101370689 (PIK3CA)
   04068 FoxO signaling pathway
    101370689 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    101370689 (PIK3CA)
   04072 Phospholipase D signaling pathway
    101370689 (PIK3CA)
   04071 Sphingolipid signaling pathway
    101370689 (PIK3CA)
   04024 cAMP signaling pathway
    101370689 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    101370689 (PIK3CA)
   04152 AMPK signaling pathway
    101370689 (PIK3CA)
   04150 mTOR signaling pathway
    101370689 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101370689 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    101370689 (PIK3CA)
   04218 Cellular senescence
    101370689 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101370689 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    101370689 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101370689 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101370689 (PIK3CA)
   04613 Neutrophil extracellular trap formation
    101370689 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    101370689 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    101370689 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    101370689 (PIK3CA)
   04660 T cell receptor signaling pathway
    101370689 (PIK3CA)
   04662 B cell receptor signaling pathway
    101370689 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    101370689 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    101370689 (PIK3CA)
   04670 Leukocyte transendothelial migration
    101370689 (PIK3CA)
   04062 Chemokine signaling pathway
    101370689 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101370689 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    101370689 (PIK3CA)
   04929 GnRH secretion
    101370689 (PIK3CA)
   04915 Estrogen signaling pathway
    101370689 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    101370689 (PIK3CA)
   04917 Prolactin signaling pathway
    101370689 (PIK3CA)
   04926 Relaxin signaling pathway
    101370689 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    101370689 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    101370689 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101370689 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101370689 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    101370689 (PIK3CA)
   04722 Neurotrophin signaling pathway
    101370689 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101370689 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    101370689 (PIK3CA)
   04380 Osteoclast differentiation
    101370689 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    101370689 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    101370689 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101370689 (PIK3CA)
   05206 MicroRNAs in cancer
    101370689 (PIK3CA)
   05205 Proteoglycans in cancer
    101370689 (PIK3CA)
   05203 Viral carcinogenesis
    101370689 (PIK3CA)
   05230 Central carbon metabolism in cancer
    101370689 (PIK3CA)
   05231 Choline metabolism in cancer
    101370689 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101370689 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101370689 (PIK3CA)
   05212 Pancreatic cancer
    101370689 (PIK3CA)
   05225 Hepatocellular carcinoma
    101370689 (PIK3CA)
   05226 Gastric cancer
    101370689 (PIK3CA)
   05214 Glioma
    101370689 (PIK3CA)
   05221 Acute myeloid leukemia
    101370689 (PIK3CA)
   05220 Chronic myeloid leukemia
    101370689 (PIK3CA)
   05218 Melanoma
    101370689 (PIK3CA)
   05211 Renal cell carcinoma
    101370689 (PIK3CA)
   05215 Prostate cancer
    101370689 (PIK3CA)
   05213 Endometrial cancer
    101370689 (PIK3CA)
   05224 Breast cancer
    101370689 (PIK3CA)
   05222 Small cell lung cancer
    101370689 (PIK3CA)
   05223 Non-small cell lung cancer
    101370689 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101370689 (PIK3CA)
   05017 Spinocerebellar ataxia
    101370689 (PIK3CA)
   05020 Prion disease
    101370689 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101370689 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101370689 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    101370689 (PIK3CA)
   04931 Insulin resistance
    101370689 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101370689 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101370689 (PIK3CA)
   05135 Yersinia infection
    101370689 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    101370689 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101370689 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    101370689 (PIK3CA)
   05161 Hepatitis B
    101370689 (PIK3CA)
   05160 Hepatitis C
    101370689 (PIK3CA)
   05171 Coronavirus disease - COVID-19
    101370689 (PIK3CA)
   05164 Influenza A
    101370689 (PIK3CA)
   05162 Measles
    101370689 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    101370689 (PIK3CA)
   05163 Human cytomegalovirus infection
    101370689 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101370689 (PIK3CA)
   05169 Epstein-Barr virus infection
    101370689 (PIK3CA)
   05165 Human papillomavirus infection
    101370689 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101370689 (PIK3CA)
   05142 Chagas disease
    101370689 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101370689 (PIK3CA)
   01524 Platinum drug resistance
    101370689 (PIK3CA)
   01522 Endocrine resistance
    101370689 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oro04131]
    101370689 (PIK3CA)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101370689 (PIK3CA)
Membrane trafficking [BR:oro04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101370689 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC Ribosomal_S15
Other DBs
NCBI-GeneID: 101370689
NCBI-ProteinID: XP_004398417
UniProt: A0A2U3VSW6
LinkDB
Position
Unknown
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccaagaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagttgaatgtttactaccaaatggaatgatagtgacgttagaatgcctccgtgaggct
acattaataactataaagcatgaattatttaaagaagcaagaaagtaccctctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctttttcaaccctttttaaaa
gtaattgagccagtaggcaaccgagaagaaaagatcctcaatcgagaaattggttttgct
attggcatgccagtgtgtgaatttgatatggttaaagatcctgaagtacaggacttccga
cgaaatattctgaatgtttgtaaagaagctgtggatcttcgggatcttaactcacctcat
agtagagcaatgtatgtctatcctccaaatgtagaatcttcaccagaactgccaaagcac
atatataataaattagataaagggcaaatcatagtggtgatttgggtaatagtttctcca
aataatgacaagcagaagtatactctgaaaatcaaccatgactgtgtgccagaacaagta
attgctgaagcaatcaggaaaaaaactagaagcatgttgctatcatctgaacaactaaaa
ctctgtgttttagaatatcagggcaaatatattttaaaagtgtgtggatgtgatgaatac
ttccttgaaaaatatcctctaagtcagtataagtacataagaagctgtataatgcttggg
aggatgcccaatttgatgctgatggctaaagaaagcctttactcccaactgccaatggac
tgtttcacaatgccttcatattccagacgcatctccacagctacaccatatatgaatgga
gaaacatctacaaaatccctttgggttataaatagtgcactcagaataaaaatcctttgt
gcgacctatgtgaatgtaaatattcgagacattgacaagatctatgttcgaacaggtatc
taccatggaggagaacccttatgcgataatgtgaacactcaaagagtaccttgttccaat
cccaggtggaatgaatggctaaattatgatatatacattcctgatcttcctcgtgctgct
cgactttgcctttccatttgttctgttaaaggccgaaagggtgctaaagaggaacactgt
ccattagcctggggaaatataaacttgtttgattacacagatactctagtatctggaaaa
atggctctgaatctttggccagtacctcatggattagaagatttgctgaaccctattggt
gttactgggtcaaatccaaataaagaaaccccatgcttagagttggagtttgactggttc
agcagtgtggtaaagttcccagatatgtcagtgattgaagagcatgccaactggtcggtg
tctcgggaagcaggatttagttattcccatgcaggactgagtaacagactagctagagac
aacgaattaagagaaaatgataaagaacagctccgagcaatttgtacccgagatcctcta
tctgaaatcactgagcaagagaaagattttctgtggagccacagacactattgtgtaact
atccctgaaattctacccaaactgcttctgtccgttaaatggaattctagagatgaagta
gcgcagatgtactgcttagtaaaagactggcctccaatcaagcctgaacaggctatggag
cttctggactgtaattacccagatcctatggttcgaggttttgctgttcggtgcttggaa
aaatacttaacagatgacaagctttctcagtacctaattcagctagtacaggtcctaaaa
tatgaacagtatttggataacctgcttgtgagatttttactcaagaaagcattgactaat
caaaggattgggcactttttcttttggcatttaaaatctgagatgcacaataaaactgtt
agtcagaggtttggccttcttttggagtcctattgtcgtgcatgcgggatgtatttgaag
cacctaaataggcaagttgaggctatggaaaagctcattaacttaactgacattctcaaa
caagagaagaaggatgaaacacaaaaggtacagatgaagtttttagttgagcagatgcgg
cgaccagatttcatggatgctctacaaggtttcctatctcctctaaatcctgctcatcaa
ctaggaaatctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagagttactctttcagaacaatgagatcatc
tttaaaaatggggatgatttacggcaagatatgctaacacttcaaataattcgcattatg
gaaaatatctggcaaaatcaaggtcttgatcttcgaatgttaccttatggttgtctgtca
attggtgactgtgtgggacttattgaggtggtgcgaaattctcacacgattatgcagatt
cagtgcaaaggtggcctgaaaggtgctctgcaattcaacagccacacactccatcagtgg
ctcaaagacaagaacaaaggagaaatatatgatgcagccattgacctgttcacacgttca
tgtgctggttattgtgtcgctaccttcattctgggcattggagatcgtcacaatagtaac
atcatggttaaagatgatggacaactgtttcatatagattttggacactttttggatcac
aagaagaaaaaatttggttataaacgggaacgtgtgccatttgttttgacacaagatttc
ttaatagtgattagtaaaggagcccaagaatgcacaaagacaagagaatttgagaggttt
caggagatgtgttacaaggcttatctagctattcggcagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaactacaatcttttgatgatattgca
tacattcgaaagaccctagctttagataaaactgaacaagaggctttggaatatttcatg
aaacaaatgaatgatgcacatcatggtggctggacaacaaaaatggattggatcttccac
acaattaagcagcatgctttgaactga

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101371800
Entry
101371800         CDS       T05148                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01521  EGFR tyrosine kinase inhibitor resistance
oro01522  Endocrine resistance
oro01524  Platinum drug resistance
oro04012  ErbB signaling pathway
oro04014  Ras signaling pathway
oro04015  Rap1 signaling pathway
oro04024  cAMP signaling pathway
oro04062  Chemokine signaling pathway
oro04066  HIF-1 signaling pathway
oro04068  FoxO signaling pathway
oro04070  Phosphatidylinositol signaling system
oro04071  Sphingolipid signaling pathway
oro04072  Phospholipase D signaling pathway
oro04140  Autophagy - animal
oro04150  mTOR signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04152  AMPK signaling pathway
oro04210  Apoptosis
oro04211  Longevity regulating pathway
oro04213  Longevity regulating pathway - multiple species
oro04218  Cellular senescence
oro04360  Axon guidance
oro04370  VEGF signaling pathway
oro04380  Osteoclast differentiation
oro04510  Focal adhesion
oro04550  Signaling pathways regulating pluripotency of stem cells
oro04611  Platelet activation
oro04613  Neutrophil extracellular trap formation
oro04620  Toll-like receptor signaling pathway
oro04625  C-type lectin receptor signaling pathway
oro04630  JAK-STAT signaling pathway
oro04650  Natural killer cell mediated cytotoxicity
oro04660  T cell receptor signaling pathway
oro04662  B cell receptor signaling pathway
oro04664  Fc epsilon RI signaling pathway
oro04666  Fc gamma R-mediated phagocytosis
oro04668  TNF signaling pathway
oro04670  Leukocyte transendothelial migration
oro04722  Neurotrophin signaling pathway
oro04725  Cholinergic synapse
oro04750  Inflammatory mediator regulation of TRP channels
oro04810  Regulation of actin cytoskeleton
oro04910  Insulin signaling pathway
oro04914  Progesterone-mediated oocyte maturation
oro04915  Estrogen signaling pathway
oro04917  Prolactin signaling pathway
oro04919  Thyroid hormone signaling pathway
oro04923  Regulation of lipolysis in adipocytes
oro04926  Relaxin signaling pathway
oro04929  GnRH secretion
oro04930  Type II diabetes mellitus
oro04931  Insulin resistance
oro04932  Non-alcoholic fatty liver disease
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro04935  Growth hormone synthesis, secretion and action
oro04960  Aldosterone-regulated sodium reabsorption
oro04973  Carbohydrate digestion and absorption
oro05010  Alzheimer disease
oro05017  Spinocerebellar ataxia
oro05020  Prion disease
oro05100  Bacterial invasion of epithelial cells
oro05135  Yersinia infection
oro05142  Chagas disease
oro05146  Amoebiasis
oro05160  Hepatitis C
oro05161  Hepatitis B
oro05162  Measles
oro05163  Human cytomegalovirus infection
oro05164  Influenza A
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05168  Herpes simplex virus 1 infection
oro05169  Epstein-Barr virus infection
oro05170  Human immunodeficiency virus 1 infection
oro05171  Coronavirus disease - COVID-19
oro05200  Pathways in cancer
oro05203  Viral carcinogenesis
oro05205  Proteoglycans in cancer
oro05206  MicroRNAs in cancer
oro05210  Colorectal cancer
oro05211  Renal cell carcinoma
oro05212  Pancreatic cancer
oro05213  Endometrial cancer
oro05214  Glioma
oro05215  Prostate cancer
oro05218  Melanoma
oro05220  Chronic myeloid leukemia
oro05221  Acute myeloid leukemia
oro05222  Small cell lung cancer
oro05223  Non-small cell lung cancer
oro05224  Breast cancer
oro05225  Hepatocellular carcinoma
oro05226  Gastric cancer
oro05230  Central carbon metabolism in cancer
oro05231  Choline metabolism in cancer
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101371800 (PIK3R2)
   04014 Ras signaling pathway
    101371800 (PIK3R2)
   04015 Rap1 signaling pathway
    101371800 (PIK3R2)
   04370 VEGF signaling pathway
    101371800 (PIK3R2)
   04630 JAK-STAT signaling pathway
    101371800 (PIK3R2)
   04668 TNF signaling pathway
    101371800 (PIK3R2)
   04066 HIF-1 signaling pathway
    101371800 (PIK3R2)
   04068 FoxO signaling pathway
    101371800 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    101371800 (PIK3R2)
   04072 Phospholipase D signaling pathway
    101371800 (PIK3R2)
   04071 Sphingolipid signaling pathway
    101371800 (PIK3R2)
   04024 cAMP signaling pathway
    101371800 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    101371800 (PIK3R2)
   04152 AMPK signaling pathway
    101371800 (PIK3R2)
   04150 mTOR signaling pathway
    101371800 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101371800 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    101371800 (PIK3R2)
   04218 Cellular senescence
    101371800 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101371800 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    101371800 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101371800 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101371800 (PIK3R2)
   04613 Neutrophil extracellular trap formation
    101371800 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    101371800 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    101371800 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    101371800 (PIK3R2)
   04660 T cell receptor signaling pathway
    101371800 (PIK3R2)
   04662 B cell receptor signaling pathway
    101371800 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    101371800 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    101371800 (PIK3R2)
   04670 Leukocyte transendothelial migration
    101371800 (PIK3R2)
   04062 Chemokine signaling pathway
    101371800 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101371800 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    101371800 (PIK3R2)
   04929 GnRH secretion
    101371800 (PIK3R2)
   04915 Estrogen signaling pathway
    101371800 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    101371800 (PIK3R2)
   04917 Prolactin signaling pathway
    101371800 (PIK3R2)
   04926 Relaxin signaling pathway
    101371800 (PIK3R2)
   04935 Growth hormone synthesis, secretion and action
    101371800 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    101371800 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101371800 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101371800 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    101371800 (PIK3R2)
   04722 Neurotrophin signaling pathway
    101371800 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101371800 (PIK3R2)
  09158 Development and regeneration
   04360 Axon guidance
    101371800 (PIK3R2)
   04380 Osteoclast differentiation
    101371800 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    101371800 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    101371800 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101371800 (PIK3R2)
   05206 MicroRNAs in cancer
    101371800 (PIK3R2)
   05205 Proteoglycans in cancer
    101371800 (PIK3R2)
   05203 Viral carcinogenesis
    101371800 (PIK3R2)
   05230 Central carbon metabolism in cancer
    101371800 (PIK3R2)
   05231 Choline metabolism in cancer
    101371800 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101371800 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101371800 (PIK3R2)
   05212 Pancreatic cancer
    101371800 (PIK3R2)
   05225 Hepatocellular carcinoma
    101371800 (PIK3R2)
   05226 Gastric cancer
    101371800 (PIK3R2)
   05214 Glioma
    101371800 (PIK3R2)
   05221 Acute myeloid leukemia
    101371800 (PIK3R2)
   05220 Chronic myeloid leukemia
    101371800 (PIK3R2)
   05218 Melanoma
    101371800 (PIK3R2)
   05211 Renal cell carcinoma
    101371800 (PIK3R2)
   05215 Prostate cancer
    101371800 (PIK3R2)
   05213 Endometrial cancer
    101371800 (PIK3R2)
   05224 Breast cancer
    101371800 (PIK3R2)
   05222 Small cell lung cancer
    101371800 (PIK3R2)
   05223 Non-small cell lung cancer
    101371800 (PIK3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101371800 (PIK3R2)
   05017 Spinocerebellar ataxia
    101371800 (PIK3R2)
   05020 Prion disease
    101371800 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101371800 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101371800 (PIK3R2)
   04932 Non-alcoholic fatty liver disease
    101371800 (PIK3R2)
   04931 Insulin resistance
    101371800 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101371800 (PIK3R2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101371800 (PIK3R2)
   05100 Bacterial invasion of epithelial cells
    101371800 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101371800 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    101371800 (PIK3R2)
   05161 Hepatitis B
    101371800 (PIK3R2)
   05160 Hepatitis C
    101371800 (PIK3R2)
   05171 Coronavirus disease - COVID-19
    101371800 (PIK3R2)
   05164 Influenza A
    101371800 (PIK3R2)
   05162 Measles
    101371800 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    101371800 (PIK3R2)
   05163 Human cytomegalovirus infection
    101371800 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101371800 (PIK3R2)
   05169 Epstein-Barr virus infection
    101371800 (PIK3R2)
   05165 Human papillomavirus infection
    101371800 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101371800 (PIK3R2)
   05142 Chagas disease
    101371800 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101371800 (PIK3R2)
   01524 Platinum drug resistance
    101371800 (PIK3R2)
   01522 Endocrine resistance
    101371800 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oro04131]
    101371800 (PIK3R2)
Membrane trafficking [BR:oro04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101371800 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 ATG11 Ribosomal_L22e Tai4
Other DBs
NCBI-GeneID: 101371800
NCBI-ProteinID: XP_004404686
UniProt: A0A2U3W8T2
LinkDB
Position
Unknown
AA seq 726 aa
MAGAEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQVLGVAEGNERCPQSVGWMPGL
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDGPPEPGLTLPDLPEQFSP
PDVAPPILVKLVEAIERTGLDSESLYRPELPALRTDWSLSDVEQWDIAALTDGVKGFLLA
LPAPLVTPEAAAEARRALREAAGPVGPALEPPTLPLHRALTLRFLLQHLGRVARRAPAPG
PAVRALGATFGPLLLRAPPPSPPPGGAPDGTESSPDFPVLLVEKLLLEHLEEQEVAPPAL
PPKPPKAKPAPAGLANGGSPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSKIQ
GEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLITHYRHESLAQYNAKLDTRLL
YPVSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIE
AFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKL
EHELRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNETE
DQYALMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVVD
GDTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALAVTLAHPVRAPGPG
PPPAAR
NT seq 2181 nt   +upstreamnt  +downstreamnt
atggctggtgctgagggcttccagtaccgcgcgctgtacccattccgccgggagcggcca
gaagacctggagctgctgccgggcgacgtgttggtggtgagccgggcagccctgcaggtg
ctgggcgtggctgagggcaacgagcgctgcccacagagcgtgggctggatgcctggcctc
aatgagcgcacgcggcaacgaggtgacttccccggcacctacgtcgagttcctgggtcct
gtagccctggcccggcctggccctcgtccacgtggcccccgcccactgcccgccaggccc
cgggatgggccccctgagccaggcctcacactccccgacctgccagagcagttctcccca
cctgatgtggctccccccatcctggtgaagctggtggaggccattgaacggacagggcta
gacagcgaatccctctacaggcctgagctgcccgccctgcgtacagactggtccctgagc
gacgtggagcagtgggacatcgcagccctgacagacggcgtcaagggcttcctgctggca
ctgcccgcgcccctcgtgactcccgaggccgcggccgaggcgcgccgggccctgcgggag
gccgcggggccggtggggccggcgctggagcccccgacgctgccgctgcaccgcgcgctc
acgctgcgcttcctgctccagcacctgggccgggtggcccggcgcgcccccgccccgggc
cccgccgtgcgagctctgggcgccaccttcgggccgctgctgctgcgcgcgccgcctccc
tcgccgccgccagggggcgcgcctgacgggactgagtccagccctgacttcccggtgctg
ctggtggagaagttgcttctggaacatctggaggagcaggaggtcgcacccccagcgctg
ccacctaaaccccccaaggcaaagcctgcccctgcaggcctggctaatggggggagcccg
ccctccctgcaggatgctgagtggtactggggtgacatctccagagaggaggtgaacgag
aagctccgggacacgcctgatggcacctttctggtccgagatgcgtctagcaagatccag
ggggagtacacactgaccctcaggaaaggcgggaacaacaagctgattaaggtcttccac
cgcgacgggcactatggcttctcagagccactcaccttctgctccgttgtggacctcatc
acccactaccgccatgagtcgctggcccagtacaatgccaagctggacacccggctcctc
taccccgtgtccaagtaccagcaggaccagatcgtcaaggaggacagtgtggaggcggtg
ggtgcccagctcaaagtctaccaccagcagtaccaggataagagccgcgaatatgaccag
ctctatgaggagtacacccgcacctcccaggaactgcagatgaagcgcacggcaattgag
gccttcaatgagaccattaagatctttgaagagcagggccagacgcaagagaagtgtagc
aaggaatatctggagcgcttccgacgtgagggcaatgagaaagagatgcagaggatcctg
ctgaactccgagcggctcaagtctcgcatcgccgagatccatgagagccgcacaaagctg
gagcacgagctgcgggcacaggcctcagacaaccgagagatcgacaagcgcatgaacagc
ctcaagccagacctcatgcagctgcgcaagatccgagaccagtacctcgtgtggcttacc
cagaagggcgcccggcagaagaaaatcaacgagtggttggggatcaaaaatgagaccgag
gaccagtatgcgctgatggaggatgaggatgacctcccccaccatgaggaacgcacgtgg
tacgtgggcaagatcaaccggacccaggctgaggaaatgctgagcggcaagcgggatggt
accttcctcatccgtgagagcagccagcggggctgctatgcctgctccgtggtggtggac
ggcgacaccaagcactgcgtcatctaccgcacggccacgggcttcggcttcgcggagccc
tacaacctgtacgggtcgctgaaggagctggtgctgcactaccagcatgcctcgctggtg
cagcacaacgatgcgctcgccgtcacgctcgcccacccggtgcgcgcgcccggccccggg
cccccgcccgccgcccgctga

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101374787
Entry
101374787         CDS       T05148                                 

Gene name
PIK3R3
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01521  EGFR tyrosine kinase inhibitor resistance
oro01522  Endocrine resistance
oro01524  Platinum drug resistance
oro04012  ErbB signaling pathway
oro04014  Ras signaling pathway
oro04015  Rap1 signaling pathway
oro04024  cAMP signaling pathway
oro04062  Chemokine signaling pathway
oro04066  HIF-1 signaling pathway
oro04068  FoxO signaling pathway
oro04070  Phosphatidylinositol signaling system
oro04071  Sphingolipid signaling pathway
oro04072  Phospholipase D signaling pathway
oro04140  Autophagy - animal
oro04150  mTOR signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04152  AMPK signaling pathway
oro04210  Apoptosis
oro04211  Longevity regulating pathway
oro04213  Longevity regulating pathway - multiple species
oro04218  Cellular senescence
oro04360  Axon guidance
oro04370  VEGF signaling pathway
oro04380  Osteoclast differentiation
oro04510  Focal adhesion
oro04550  Signaling pathways regulating pluripotency of stem cells
oro04611  Platelet activation
oro04613  Neutrophil extracellular trap formation
oro04620  Toll-like receptor signaling pathway
oro04625  C-type lectin receptor signaling pathway
oro04630  JAK-STAT signaling pathway
oro04650  Natural killer cell mediated cytotoxicity
oro04660  T cell receptor signaling pathway
oro04662  B cell receptor signaling pathway
oro04664  Fc epsilon RI signaling pathway
oro04666  Fc gamma R-mediated phagocytosis
oro04668  TNF signaling pathway
oro04670  Leukocyte transendothelial migration
oro04722  Neurotrophin signaling pathway
oro04725  Cholinergic synapse
oro04750  Inflammatory mediator regulation of TRP channels
oro04810  Regulation of actin cytoskeleton
oro04910  Insulin signaling pathway
oro04914  Progesterone-mediated oocyte maturation
oro04915  Estrogen signaling pathway
oro04917  Prolactin signaling pathway
oro04919  Thyroid hormone signaling pathway
oro04923  Regulation of lipolysis in adipocytes
oro04926  Relaxin signaling pathway
oro04929  GnRH secretion
oro04930  Type II diabetes mellitus
oro04931  Insulin resistance
oro04932  Non-alcoholic fatty liver disease
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro04935  Growth hormone synthesis, secretion and action
oro04960  Aldosterone-regulated sodium reabsorption
oro04973  Carbohydrate digestion and absorption
oro05010  Alzheimer disease
oro05017  Spinocerebellar ataxia
oro05020  Prion disease
oro05100  Bacterial invasion of epithelial cells
oro05135  Yersinia infection
oro05142  Chagas disease
oro05146  Amoebiasis
oro05160  Hepatitis C
oro05161  Hepatitis B
oro05162  Measles
oro05163  Human cytomegalovirus infection
oro05164  Influenza A
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05168  Herpes simplex virus 1 infection
oro05169  Epstein-Barr virus infection
oro05170  Human immunodeficiency virus 1 infection
oro05171  Coronavirus disease - COVID-19
oro05200  Pathways in cancer
oro05203  Viral carcinogenesis
oro05205  Proteoglycans in cancer
oro05206  MicroRNAs in cancer
oro05210  Colorectal cancer
oro05211  Renal cell carcinoma
oro05212  Pancreatic cancer
oro05213  Endometrial cancer
oro05214  Glioma
oro05215  Prostate cancer
oro05218  Melanoma
oro05220  Chronic myeloid leukemia
oro05221  Acute myeloid leukemia
oro05222  Small cell lung cancer
oro05223  Non-small cell lung cancer
oro05224  Breast cancer
oro05225  Hepatocellular carcinoma
oro05226  Gastric cancer
oro05230  Central carbon metabolism in cancer
oro05231  Choline metabolism in cancer
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101374787 (PIK3R3)
   04014 Ras signaling pathway
    101374787 (PIK3R3)
   04015 Rap1 signaling pathway
    101374787 (PIK3R3)
   04370 VEGF signaling pathway
    101374787 (PIK3R3)
   04630 JAK-STAT signaling pathway
    101374787 (PIK3R3)
   04668 TNF signaling pathway
    101374787 (PIK3R3)
   04066 HIF-1 signaling pathway
    101374787 (PIK3R3)
   04068 FoxO signaling pathway
    101374787 (PIK3R3)
   04070 Phosphatidylinositol signaling system
    101374787 (PIK3R3)
   04072 Phospholipase D signaling pathway
    101374787 (PIK3R3)
   04071 Sphingolipid signaling pathway
    101374787 (PIK3R3)
   04024 cAMP signaling pathway
    101374787 (PIK3R3)
   04151 PI3K-Akt signaling pathway
    101374787 (PIK3R3)
   04152 AMPK signaling pathway
    101374787 (PIK3R3)
   04150 mTOR signaling pathway
    101374787 (PIK3R3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101374787 (PIK3R3)
  09143 Cell growth and death
   04210 Apoptosis
    101374787 (PIK3R3)
   04218 Cellular senescence
    101374787 (PIK3R3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101374787 (PIK3R3)
   04550 Signaling pathways regulating pluripotency of stem cells
    101374787 (PIK3R3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101374787 (PIK3R3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101374787 (PIK3R3)
   04613 Neutrophil extracellular trap formation
    101374787 (PIK3R3)
   04620 Toll-like receptor signaling pathway
    101374787 (PIK3R3)
   04625 C-type lectin receptor signaling pathway
    101374787 (PIK3R3)
   04650 Natural killer cell mediated cytotoxicity
    101374787 (PIK3R3)
   04660 T cell receptor signaling pathway
    101374787 (PIK3R3)
   04662 B cell receptor signaling pathway
    101374787 (PIK3R3)
   04664 Fc epsilon RI signaling pathway
    101374787 (PIK3R3)
   04666 Fc gamma R-mediated phagocytosis
    101374787 (PIK3R3)
   04670 Leukocyte transendothelial migration
    101374787 (PIK3R3)
   04062 Chemokine signaling pathway
    101374787 (PIK3R3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101374787 (PIK3R3)
   04923 Regulation of lipolysis in adipocytes
    101374787 (PIK3R3)
   04929 GnRH secretion
    101374787 (PIK3R3)
   04915 Estrogen signaling pathway
    101374787 (PIK3R3)
   04914 Progesterone-mediated oocyte maturation
    101374787 (PIK3R3)
   04917 Prolactin signaling pathway
    101374787 (PIK3R3)
   04926 Relaxin signaling pathway
    101374787 (PIK3R3)
   04935 Growth hormone synthesis, secretion and action
    101374787 (PIK3R3)
   04919 Thyroid hormone signaling pathway
    101374787 (PIK3R3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101374787 (PIK3R3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101374787 (PIK3R3)
  09156 Nervous system
   04725 Cholinergic synapse
    101374787 (PIK3R3)
   04722 Neurotrophin signaling pathway
    101374787 (PIK3R3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101374787 (PIK3R3)
  09158 Development and regeneration
   04360 Axon guidance
    101374787 (PIK3R3)
   04380 Osteoclast differentiation
    101374787 (PIK3R3)
  09149 Aging
   04211 Longevity regulating pathway
    101374787 (PIK3R3)
   04213 Longevity regulating pathway - multiple species
    101374787 (PIK3R3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101374787 (PIK3R3)
   05206 MicroRNAs in cancer
    101374787 (PIK3R3)
   05205 Proteoglycans in cancer
    101374787 (PIK3R3)
   05203 Viral carcinogenesis
    101374787 (PIK3R3)
   05230 Central carbon metabolism in cancer
    101374787 (PIK3R3)
   05231 Choline metabolism in cancer
    101374787 (PIK3R3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101374787 (PIK3R3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101374787 (PIK3R3)
   05212 Pancreatic cancer
    101374787 (PIK3R3)
   05225 Hepatocellular carcinoma
    101374787 (PIK3R3)
   05226 Gastric cancer
    101374787 (PIK3R3)
   05214 Glioma
    101374787 (PIK3R3)
   05221 Acute myeloid leukemia
    101374787 (PIK3R3)
   05220 Chronic myeloid leukemia
    101374787 (PIK3R3)
   05218 Melanoma
    101374787 (PIK3R3)
   05211 Renal cell carcinoma
    101374787 (PIK3R3)
   05215 Prostate cancer
    101374787 (PIK3R3)
   05213 Endometrial cancer
    101374787 (PIK3R3)
   05224 Breast cancer
    101374787 (PIK3R3)
   05222 Small cell lung cancer
    101374787 (PIK3R3)
   05223 Non-small cell lung cancer
    101374787 (PIK3R3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101374787 (PIK3R3)
   05017 Spinocerebellar ataxia
    101374787 (PIK3R3)
   05020 Prion disease
    101374787 (PIK3R3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101374787 (PIK3R3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101374787 (PIK3R3)
   04932 Non-alcoholic fatty liver disease
    101374787 (PIK3R3)
   04931 Insulin resistance
    101374787 (PIK3R3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101374787 (PIK3R3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101374787 (PIK3R3)
   05100 Bacterial invasion of epithelial cells
    101374787 (PIK3R3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101374787 (PIK3R3)
   05170 Human immunodeficiency virus 1 infection
    101374787 (PIK3R3)
   05161 Hepatitis B
    101374787 (PIK3R3)
   05160 Hepatitis C
    101374787 (PIK3R3)
   05171 Coronavirus disease - COVID-19
    101374787 (PIK3R3)
   05164 Influenza A
    101374787 (PIK3R3)
   05162 Measles
    101374787 (PIK3R3)
   05168 Herpes simplex virus 1 infection
    101374787 (PIK3R3)
   05163 Human cytomegalovirus infection
    101374787 (PIK3R3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101374787 (PIK3R3)
   05169 Epstein-Barr virus infection
    101374787 (PIK3R3)
   05165 Human papillomavirus infection
    101374787 (PIK3R3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101374787 (PIK3R3)
   05142 Chagas disease
    101374787 (PIK3R3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101374787 (PIK3R3)
   01524 Platinum drug resistance
    101374787 (PIK3R3)
   01522 Endocrine resistance
    101374787 (PIK3R3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oro04131]
    101374787 (PIK3R3)
Membrane trafficking [BR:oro04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101374787 (PIK3R3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Transcrip_act Mod_r DUF5638 Fez1
Other DBs
NCBI-GeneID: 101374787
NCBI-ProteinID: XP_004400645
UniProt: A0A2U3VYN3
LinkDB
Position
Unknown
AA seq 507 aa
MGPSQPVRAPRPRGLSSPYRRPGLGWPRPRNPRMFKCSRRRYRQKPQGPAATTAATNPAT
VATDINNTPTTTTSVWILPPQTLPPKPPKPMTSAVTNGMKDSSVSLQDAEWYWGDISREE
VNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDGKYGFSDPLTFNSVV
ELINHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKKLQEYHSQYQEKSKE
YDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEYIERFRREGNEKEIE
RIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKPDLIQLRKIRDQHLV
WLNHKGVRQKRLNAWLGIKNEDADETYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYG
KPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYNLYSSLKELVLHYQQ
TSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggggccttctcagcctgtccgtgcccctcggccccggggcctaagttccccctaccgc
aggccagggctgggctggcctcggcctcgaaatcccaggatgttcaagtgtagccgcaga
aggtaccggcagaaaccccaaggcccagctgccaccactgcagccaccaatcctgccacc
gtggccacagatatcaacaacactcctaccaccaccaccagtgtgtggatccttccgcca
caaactcttccaccaaagccacctaagccaatgacttcagccgttacaaatggaatgaag
gacagttctgtttctcttcaggatgcagaatggtactggggggatatttcaagggaggag
gtaaatgacaaattacgggatatgccagatggtacgttcttggtcagagatgcctcaaca
aaaatgcagggggattacactttgactttgcggaagggaggcaataataagttaataaag
atctatcatcgagatggtaaatacggcttttctgatcctctgacatttaattctgtggtg
gagctcattaaccactatcatcatgaatctcttgctcagtacaatcccaaacttgatgtg
aagctaatgtacccagtgtccagataccaacaggatcagttggtaaaagaagacaacatt
gatgcagttggtaaaaaactgcaagagtaccactctcagtatcaggaaaagagtaaagag
tatgacaggctatatgaggaatataccagaacgtcccaggaaatacagatgaagaggact
gcaattgaagcttttaatgaaacaattaaaatatttgaagagcagtgtcacacacaagaa
caacatagcaaagaatatattgagcggtttcgcagagaggggaatgaaaaggaaattgaa
cgaattatgatgaattatgacaaattgaaatcacgtctgggtgagattcatgatagcaaa
atgcgtctagagcaggatttgaagaaacaagctttggacaaccgggaaatagataaaaaa
atgaacagtatcaaacctgacctgatccagctgcgcaagatccgagatcagcaccttgta
tggctcaatcacaaaggagtgagacagaagcgcctaaatgcctggctgggaatcaagaat
gaggatgctgatgagacctattttatcaatgaggaagatgaaaacctgccccattatgat
gagaaaacctggtttgttgaggatatcaatcgagtacaagcagaggacttgctttatggg
aaacctgatggtgcatttttaattcgtgagagtagcaagaaaggatgttatgcttgctct
gtggttgccgacggggaagtgaagcactgtgtgatctacagcactgctcggggctatggc
tttgcagagccctacaacctgtacagctccctgaaggagctagtgctccattaccagcag
acctccctcgttcagcacaacgactccctcaacgtcaggcttgcctaccctgtccacgca
cagatgccctcactctgcagataa

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101385241
Entry
101385241         CDS       T05148                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00562  Inositol phosphate metabolism
oro01100  Metabolic pathways
oro01521  EGFR tyrosine kinase inhibitor resistance
oro01522  Endocrine resistance
oro01524  Platinum drug resistance
oro04012  ErbB signaling pathway
oro04014  Ras signaling pathway
oro04015  Rap1 signaling pathway
oro04024  cAMP signaling pathway
oro04062  Chemokine signaling pathway
oro04066  HIF-1 signaling pathway
oro04068  FoxO signaling pathway
oro04070  Phosphatidylinositol signaling system
oro04071  Sphingolipid signaling pathway
oro04072  Phospholipase D signaling pathway
oro04140  Autophagy - animal
oro04150  mTOR signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04152  AMPK signaling pathway
oro04210  Apoptosis
oro04211  Longevity regulating pathway
oro04213  Longevity regulating pathway - multiple species
oro04218  Cellular senescence
oro04360  Axon guidance
oro04370  VEGF signaling pathway
oro04380  Osteoclast differentiation
oro04510  Focal adhesion
oro04550  Signaling pathways regulating pluripotency of stem cells
oro04611  Platelet activation
oro04613  Neutrophil extracellular trap formation
oro04620  Toll-like receptor signaling pathway
oro04625  C-type lectin receptor signaling pathway
oro04630  JAK-STAT signaling pathway
oro04650  Natural killer cell mediated cytotoxicity
oro04660  T cell receptor signaling pathway
oro04662  B cell receptor signaling pathway
oro04664  Fc epsilon RI signaling pathway
oro04666  Fc gamma R-mediated phagocytosis
oro04668  TNF signaling pathway
oro04670  Leukocyte transendothelial migration
oro04722  Neurotrophin signaling pathway
oro04725  Cholinergic synapse
oro04750  Inflammatory mediator regulation of TRP channels
oro04810  Regulation of actin cytoskeleton
oro04910  Insulin signaling pathway
oro04914  Progesterone-mediated oocyte maturation
oro04915  Estrogen signaling pathway
oro04917  Prolactin signaling pathway
oro04919  Thyroid hormone signaling pathway
oro04923  Regulation of lipolysis in adipocytes
oro04926  Relaxin signaling pathway
oro04929  GnRH secretion
oro04930  Type II diabetes mellitus
oro04931  Insulin resistance
oro04932  Non-alcoholic fatty liver disease
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro04935  Growth hormone synthesis, secretion and action
oro04960  Aldosterone-regulated sodium reabsorption
oro04973  Carbohydrate digestion and absorption
oro05010  Alzheimer disease
oro05017  Spinocerebellar ataxia
oro05020  Prion disease
oro05100  Bacterial invasion of epithelial cells
oro05132  Salmonella infection
oro05135  Yersinia infection
oro05142  Chagas disease
oro05146  Amoebiasis
oro05160  Hepatitis C
oro05161  Hepatitis B
oro05162  Measles
oro05163  Human cytomegalovirus infection
oro05164  Influenza A
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05168  Herpes simplex virus 1 infection
oro05169  Epstein-Barr virus infection
oro05170  Human immunodeficiency virus 1 infection
oro05171  Coronavirus disease - COVID-19
oro05200  Pathways in cancer
oro05203  Viral carcinogenesis
oro05205  Proteoglycans in cancer
oro05206  MicroRNAs in cancer
oro05210  Colorectal cancer
oro05211  Renal cell carcinoma
oro05212  Pancreatic cancer
oro05213  Endometrial cancer
oro05214  Glioma
oro05215  Prostate cancer
oro05218  Melanoma
oro05220  Chronic myeloid leukemia
oro05221  Acute myeloid leukemia
oro05222  Small cell lung cancer
oro05223  Non-small cell lung cancer
oro05224  Breast cancer
oro05225  Hepatocellular carcinoma
oro05226  Gastric cancer
oro05230  Central carbon metabolism in cancer
oro05231  Choline metabolism in cancer
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101385241 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101385241 (PIK3CB)
   04014 Ras signaling pathway
    101385241 (PIK3CB)
   04015 Rap1 signaling pathway
    101385241 (PIK3CB)
   04370 VEGF signaling pathway
    101385241 (PIK3CB)
   04630 JAK-STAT signaling pathway
    101385241 (PIK3CB)
   04668 TNF signaling pathway
    101385241 (PIK3CB)
   04066 HIF-1 signaling pathway
    101385241 (PIK3CB)
   04068 FoxO signaling pathway
    101385241 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    101385241 (PIK3CB)
   04072 Phospholipase D signaling pathway
    101385241 (PIK3CB)
   04071 Sphingolipid signaling pathway
    101385241 (PIK3CB)
   04024 cAMP signaling pathway
    101385241 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    101385241 (PIK3CB)
   04152 AMPK signaling pathway
    101385241 (PIK3CB)
   04150 mTOR signaling pathway
    101385241 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101385241 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    101385241 (PIK3CB)
   04218 Cellular senescence
    101385241 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101385241 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    101385241 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101385241 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101385241 (PIK3CB)
   04613 Neutrophil extracellular trap formation
    101385241 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    101385241 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    101385241 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    101385241 (PIK3CB)
   04660 T cell receptor signaling pathway
    101385241 (PIK3CB)
   04662 B cell receptor signaling pathway
    101385241 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    101385241 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    101385241 (PIK3CB)
   04670 Leukocyte transendothelial migration
    101385241 (PIK3CB)
   04062 Chemokine signaling pathway
    101385241 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101385241 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    101385241 (PIK3CB)
   04929 GnRH secretion
    101385241 (PIK3CB)
   04915 Estrogen signaling pathway
    101385241 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    101385241 (PIK3CB)
   04917 Prolactin signaling pathway
    101385241 (PIK3CB)
   04926 Relaxin signaling pathway
    101385241 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    101385241 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    101385241 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101385241 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101385241 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    101385241 (PIK3CB)
   04722 Neurotrophin signaling pathway
    101385241 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101385241 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    101385241 (PIK3CB)
   04380 Osteoclast differentiation
    101385241 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    101385241 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    101385241 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101385241 (PIK3CB)
   05206 MicroRNAs in cancer
    101385241 (PIK3CB)
   05205 Proteoglycans in cancer
    101385241 (PIK3CB)
   05203 Viral carcinogenesis
    101385241 (PIK3CB)
   05230 Central carbon metabolism in cancer
    101385241 (PIK3CB)
   05231 Choline metabolism in cancer
    101385241 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101385241 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101385241 (PIK3CB)
   05212 Pancreatic cancer
    101385241 (PIK3CB)
   05225 Hepatocellular carcinoma
    101385241 (PIK3CB)
   05226 Gastric cancer
    101385241 (PIK3CB)
   05214 Glioma
    101385241 (PIK3CB)
   05221 Acute myeloid leukemia
    101385241 (PIK3CB)
   05220 Chronic myeloid leukemia
    101385241 (PIK3CB)
   05218 Melanoma
    101385241 (PIK3CB)
   05211 Renal cell carcinoma
    101385241 (PIK3CB)
   05215 Prostate cancer
    101385241 (PIK3CB)
   05213 Endometrial cancer
    101385241 (PIK3CB)
   05224 Breast cancer
    101385241 (PIK3CB)
   05222 Small cell lung cancer
    101385241 (PIK3CB)
   05223 Non-small cell lung cancer
    101385241 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101385241 (PIK3CB)
   05017 Spinocerebellar ataxia
    101385241 (PIK3CB)
   05020 Prion disease
    101385241 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101385241 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101385241 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    101385241 (PIK3CB)
   04931 Insulin resistance
    101385241 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101385241 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101385241 (PIK3CB)
   05135 Yersinia infection
    101385241 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    101385241 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101385241 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    101385241 (PIK3CB)
   05161 Hepatitis B
    101385241 (PIK3CB)
   05160 Hepatitis C
    101385241 (PIK3CB)
   05171 Coronavirus disease - COVID-19
    101385241 (PIK3CB)
   05164 Influenza A
    101385241 (PIK3CB)
   05162 Measles
    101385241 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    101385241 (PIK3CB)
   05163 Human cytomegalovirus infection
    101385241 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101385241 (PIK3CB)
   05169 Epstein-Barr virus infection
    101385241 (PIK3CB)
   05165 Human papillomavirus infection
    101385241 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101385241 (PIK3CB)
   05142 Chagas disease
    101385241 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101385241 (PIK3CB)
   01524 Platinum drug resistance
    101385241 (PIK3CB)
   01522 Endocrine resistance
    101385241 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oro04131]
    101385241 (PIK3CB)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101385241 (PIK3CB)
Membrane trafficking [BR:oro04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101385241 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C DUF4381
Other DBs
NCBI-GeneID: 101385241
NCBI-ProteinID: XP_004413293
UniProt: A0A2U3WV15
LinkDB
Position
Unknown
AA seq 1070 aa
MCFSFIMPPAMADILDIWAVDSQLASDGSIPVDFLLPTGIYIQLEVPREATISYIKQILW
KQVHNYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGKGLHEFDALKDPEVNEFRIKMRKFSEEKIQSLVGLSWMDWLKQTYPPEH
EPSILENLEDKLYGGKLIVAVHFENCQDVFSFQISPNMNPIKINELAIQKRLTIHGKEDE
VSPYDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFMLVECFKIKKMYEQEMIAI
EAAINRNSSNLPLPLPPKKMRIISHVWENNNPFQIVLVKGNKLNTEESVKVHVRAGLFHG
TELLCKTIVSSEISGKNDHIWNEPLEFDINTCDLPRMARLCFAVYAVLDKVKTKKSTKTI
NPCKYQTIRKSGKVHYPVAWVNTMVFDFKGQLRSGDIILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLAVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVDCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALANRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKVLSKQVEALNKLK
TLNSLIKLNAMKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCVILSELYVEKCKYMD
SKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgtgcttcagtttcataatgcctcctgctatggcagacatccttgacatctgggcagtg
gattcacagttagcatctgatggctccatacctgtggatttccttttgcccactgggatt
tatattcagttggaggttcctcgggaagctaccatttcctatattaaacagatattatgg
aagcaagttcacaattacccaatgtttaacctccttatggaaattgactcctatatgttt
gcatgtgtgaatcaaactgctgtatatgaggaacttgaagatgaaacaagaagactttgt
gatgtcagaccttttcttccagttctcaaattagtgacaagaagttgtgacccaggggaa
aaattagactcaaaaattggagtccttataggaaaaggtctacatgaatttgatgcactg
aaggatcctgaagtgaatgaattccgaataaaaatgcgcaaattcagtgaggaaaagatt
cagtcgcttgtgggattgtcttggatggattggctaaagcagacatatccaccagaacat
gaaccatcaatccttgaaaacttagaagataaactatatggaggaaagctcattgtggct
gttcattttgaaaattgtcaggatgtgtttagctttcaaatatctcctaatatgaatcct
atcaaaataaatgaactggcaatccaaaaacgtttgactattcatgggaaagaagatgaa
gttagtccctatgactatgtgttgcaagtcagtgggagagtagaatatgtgtttggtgat
cacccactcattcagttccagtatatccggaattgtgtaatgaacaggaccttgccccat
tttatgcttgtggaatgtttcaagatcaagaagatgtatgaacaggaaatgattgccata
gaggctgccataaatcgaaattcatcaaaccttcctctgcctttaccaccaaagaaaatg
cgaattatttctcatgtttgggaaaataacaaccctttccagattgtcttggttaaggga
aataaacttaacacagaagaaagtgtaaaagttcatgtcagggctggcctttttcatggt
actgaactcctctgtaaaaccattgtaagctcagagatatcagggaaaaatgatcacatt
tggaatgaaccactggaatttgatataaatacatgtgaccttccacgaatggctcgatta
tgttttgctgtttatgcagttttggataaagtgaaaacgaaaaagtcgactaaaactatt
aatccctgtaaatatcagaccatccggaaatctgggaaagtgcattatcctgtagcgtgg
gtaaatacgatggtttttgactttaaaggacagttgagatctggagacataatattgcac
agctggtcttcatttcctgatgaacttgaagaaatgttgaatccaatgggaactgttcaa
acaaatccatatactgaaaatgcaacagctttgcatatcaaattcccagagaataaaaaa
caaccttattattatcctcccttcgataagataatcgagaaggcagctgagattgcaagc
agtgacagtgctaatgtatcaagtcgaggtggaaaaaagtttcttgctgtactgaaagaa
atcttggacagggatcccttgtctcagttgtgtgagaatgaaatggatcttatttggact
ttgcgacaagattgcagagagaatttcccacagtcactgccaaaattactgctgtcaatc
aagtggaataaacttgaggatgttgctcagcttcaggcactacttcagatttggcctaaa
ctgcccccccgggaggccttagagcttctagatttcaactatccagatcagtacgtgcga
gaatatgctgtggactgcctgcgacagatgagtgatgaagaactctctcaatatctttta
caactggtgcaagttttaaaatatgagccttttcttgattgtgccctctctagattccta
ttagaaagagcactggctaatcgcaggatagggcagtttctattttggcaccttaggtca
gaagtgcatattcctgctgtctcagtacaatttggtgtcatccttgaagcctactgccgg
ggaagcgtagggcacatgaaagtgctttccaagcaggttgaagcactcaataagttaaaa
actttaaatagtttaatcaaactgaatgcgatgaagctaaacagagccaaagggaaggag
gccatgcatacttgtttaaaacagaatgcttaccgggaagccctctctgacctgcagtcg
cctctgaatccatgtgttatcctctcagaactctatgttgaaaagtgtaaatacatggat
tccaaaatgaagcctttgtggctcgtgtacaacaacaaagtgtttggtgaggattcagtt
ggagtgatttttaaaaatggtgatgatttacgacaagatatgttgacactccaaatgctg
cgcttgatggatttactttggaaagaagctggtctggatcttcggatgctgccttatggc
tgtttagcaacaggagaccgctctggcctcattgaagttgtgagcacctctgaaacaatt
gctgacattcagctgaacagtagcaatgtggctgctgcagcagccttcaacaaagatgcc
cttctgaactggcttaaagaatacaactctggggatgacctagaccgagccattgaggag
tttaccttgtcctgtgccggctactgtgtagcttcttatgtccttgggattggtgataga
cacagtgacaacatcatggtcaaaaaaaccggccagctcttccacattgactttggacat
attcttggaaatttcaagtctaaatttggcattaaaagggaacgggtgccttttattctt
acctatgatttcattcatgtgattcaacaaggaaaaacaggaaacacagagaagtttggc
cgcttccgccagtgttgtgaggatgcatatctgattttacgacggcacgggaatctcttc
atcacgctttttgcactgatgttgactgcagggcttcctgagctcacatcagtcaaggat
atacagtatctgaaggactctcttgccttagggaagagtgaagaagaagcactcaagcaa
tttaagcaaaaatttgacgaggcactcagggaaagctggactactaaagtgaactggatg
gcccacacagttcggaaagactacagatcttaa

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101385267
Entry
101385267         CDS       T05148                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00562  Inositol phosphate metabolism
oro01100  Metabolic pathways
oro01521  EGFR tyrosine kinase inhibitor resistance
oro01522  Endocrine resistance
oro01524  Platinum drug resistance
oro04012  ErbB signaling pathway
oro04014  Ras signaling pathway
oro04015  Rap1 signaling pathway
oro04024  cAMP signaling pathway
oro04062  Chemokine signaling pathway
oro04066  HIF-1 signaling pathway
oro04068  FoxO signaling pathway
oro04070  Phosphatidylinositol signaling system
oro04071  Sphingolipid signaling pathway
oro04072  Phospholipase D signaling pathway
oro04140  Autophagy - animal
oro04150  mTOR signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04152  AMPK signaling pathway
oro04210  Apoptosis
oro04211  Longevity regulating pathway
oro04213  Longevity regulating pathway - multiple species
oro04218  Cellular senescence
oro04360  Axon guidance
oro04370  VEGF signaling pathway
oro04380  Osteoclast differentiation
oro04510  Focal adhesion
oro04550  Signaling pathways regulating pluripotency of stem cells
oro04611  Platelet activation
oro04613  Neutrophil extracellular trap formation
oro04620  Toll-like receptor signaling pathway
oro04625  C-type lectin receptor signaling pathway
oro04630  JAK-STAT signaling pathway
oro04650  Natural killer cell mediated cytotoxicity
oro04660  T cell receptor signaling pathway
oro04662  B cell receptor signaling pathway
oro04664  Fc epsilon RI signaling pathway
oro04666  Fc gamma R-mediated phagocytosis
oro04668  TNF signaling pathway
oro04670  Leukocyte transendothelial migration
oro04722  Neurotrophin signaling pathway
oro04725  Cholinergic synapse
oro04750  Inflammatory mediator regulation of TRP channels
oro04810  Regulation of actin cytoskeleton
oro04910  Insulin signaling pathway
oro04914  Progesterone-mediated oocyte maturation
oro04915  Estrogen signaling pathway
oro04917  Prolactin signaling pathway
oro04919  Thyroid hormone signaling pathway
oro04923  Regulation of lipolysis in adipocytes
oro04926  Relaxin signaling pathway
oro04929  GnRH secretion
oro04930  Type II diabetes mellitus
oro04931  Insulin resistance
oro04932  Non-alcoholic fatty liver disease
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro04935  Growth hormone synthesis, secretion and action
oro04960  Aldosterone-regulated sodium reabsorption
oro04973  Carbohydrate digestion and absorption
oro05010  Alzheimer disease
oro05017  Spinocerebellar ataxia
oro05020  Prion disease
oro05100  Bacterial invasion of epithelial cells
oro05132  Salmonella infection
oro05135  Yersinia infection
oro05142  Chagas disease
oro05146  Amoebiasis
oro05160  Hepatitis C
oro05161  Hepatitis B
oro05162  Measles
oro05163  Human cytomegalovirus infection
oro05164  Influenza A
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05168  Herpes simplex virus 1 infection
oro05169  Epstein-Barr virus infection
oro05170  Human immunodeficiency virus 1 infection
oro05171  Coronavirus disease - COVID-19
oro05200  Pathways in cancer
oro05203  Viral carcinogenesis
oro05205  Proteoglycans in cancer
oro05206  MicroRNAs in cancer
oro05210  Colorectal cancer
oro05211  Renal cell carcinoma
oro05212  Pancreatic cancer
oro05213  Endometrial cancer
oro05214  Glioma
oro05215  Prostate cancer
oro05218  Melanoma
oro05220  Chronic myeloid leukemia
oro05221  Acute myeloid leukemia
oro05222  Small cell lung cancer
oro05223  Non-small cell lung cancer
oro05224  Breast cancer
oro05225  Hepatocellular carcinoma
oro05226  Gastric cancer
oro05230  Central carbon metabolism in cancer
oro05231  Choline metabolism in cancer
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101385267 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101385267 (PIK3CD)
   04014 Ras signaling pathway
    101385267 (PIK3CD)
   04015 Rap1 signaling pathway
    101385267 (PIK3CD)
   04370 VEGF signaling pathway
    101385267 (PIK3CD)
   04630 JAK-STAT signaling pathway
    101385267 (PIK3CD)
   04668 TNF signaling pathway
    101385267 (PIK3CD)
   04066 HIF-1 signaling pathway
    101385267 (PIK3CD)
   04068 FoxO signaling pathway
    101385267 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    101385267 (PIK3CD)
   04072 Phospholipase D signaling pathway
    101385267 (PIK3CD)
   04071 Sphingolipid signaling pathway
    101385267 (PIK3CD)
   04024 cAMP signaling pathway
    101385267 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    101385267 (PIK3CD)
   04152 AMPK signaling pathway
    101385267 (PIK3CD)
   04150 mTOR signaling pathway
    101385267 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101385267 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    101385267 (PIK3CD)
   04218 Cellular senescence
    101385267 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101385267 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    101385267 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101385267 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101385267 (PIK3CD)
   04613 Neutrophil extracellular trap formation
    101385267 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    101385267 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    101385267 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    101385267 (PIK3CD)
   04660 T cell receptor signaling pathway
    101385267 (PIK3CD)
   04662 B cell receptor signaling pathway
    101385267 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    101385267 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    101385267 (PIK3CD)
   04670 Leukocyte transendothelial migration
    101385267 (PIK3CD)
   04062 Chemokine signaling pathway
    101385267 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101385267 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    101385267 (PIK3CD)
   04929 GnRH secretion
    101385267 (PIK3CD)
   04915 Estrogen signaling pathway
    101385267 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    101385267 (PIK3CD)
   04917 Prolactin signaling pathway
    101385267 (PIK3CD)
   04926 Relaxin signaling pathway
    101385267 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    101385267 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    101385267 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101385267 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101385267 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    101385267 (PIK3CD)
   04722 Neurotrophin signaling pathway
    101385267 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101385267 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    101385267 (PIK3CD)
   04380 Osteoclast differentiation
    101385267 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    101385267 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    101385267 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101385267 (PIK3CD)
   05206 MicroRNAs in cancer
    101385267 (PIK3CD)
   05205 Proteoglycans in cancer
    101385267 (PIK3CD)
   05203 Viral carcinogenesis
    101385267 (PIK3CD)
   05230 Central carbon metabolism in cancer
    101385267 (PIK3CD)
   05231 Choline metabolism in cancer
    101385267 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101385267 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101385267 (PIK3CD)
   05212 Pancreatic cancer
    101385267 (PIK3CD)
   05225 Hepatocellular carcinoma
    101385267 (PIK3CD)
   05226 Gastric cancer
    101385267 (PIK3CD)
   05214 Glioma
    101385267 (PIK3CD)
   05221 Acute myeloid leukemia
    101385267 (PIK3CD)
   05220 Chronic myeloid leukemia
    101385267 (PIK3CD)
   05218 Melanoma
    101385267 (PIK3CD)
   05211 Renal cell carcinoma
    101385267 (PIK3CD)
   05215 Prostate cancer
    101385267 (PIK3CD)
   05213 Endometrial cancer
    101385267 (PIK3CD)
   05224 Breast cancer
    101385267 (PIK3CD)
   05222 Small cell lung cancer
    101385267 (PIK3CD)
   05223 Non-small cell lung cancer
    101385267 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101385267 (PIK3CD)
   05017 Spinocerebellar ataxia
    101385267 (PIK3CD)
   05020 Prion disease
    101385267 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101385267 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101385267 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    101385267 (PIK3CD)
   04931 Insulin resistance
    101385267 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101385267 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101385267 (PIK3CD)
   05135 Yersinia infection
    101385267 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    101385267 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101385267 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    101385267 (PIK3CD)
   05161 Hepatitis B
    101385267 (PIK3CD)
   05160 Hepatitis C
    101385267 (PIK3CD)
   05171 Coronavirus disease - COVID-19
    101385267 (PIK3CD)
   05164 Influenza A
    101385267 (PIK3CD)
   05162 Measles
    101385267 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    101385267 (PIK3CD)
   05163 Human cytomegalovirus infection
    101385267 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101385267 (PIK3CD)
   05169 Epstein-Barr virus infection
    101385267 (PIK3CD)
   05165 Human papillomavirus infection
    101385267 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101385267 (PIK3CD)
   05142 Chagas disease
    101385267 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101385267 (PIK3CD)
   01524 Platinum drug resistance
    101385267 (PIK3CD)
   01522 Endocrine resistance
    101385267 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oro04131]
    101385267 (PIK3CD)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101385267 (PIK3CD)
Membrane trafficking [BR:oro04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101385267 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 101385267
NCBI-ProteinID: XP_004397625
UniProt: A0A2U3VQZ1
LinkDB
Position
Unknown
AA seq 1044 aa
MPPGVDCPMEFWTKEENQSVAVDFLLPTGVYLNFPVSRNANLSTIKKVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLVNSQISLL
IGKGLHEFDSLHDPEVNAFRSKMRQFCEEAAARRQQLGWEAWLQYSFPLQLEPSARSWGA
GTVRVPTRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYT
LQVNGKHEYLYGSYPLYQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSDPAPQVQKPR
TKPPPIPMKKPSSLSLWSLEQPFRVELIQGSKVNADERMKLVVQAGLFHGNETLCKTVSS
SEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGECCLYMWPSVPDEKGELLNPTGTVRSNPNTESAAALVICLPEVAP
YPVYYPTLDKILELGRHGEHGRFSEEEQLQLREILERRGSGELYEHEKDLVWKMRHEVQE
RFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDRHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSV
ALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALSDFVKVSSQKTTKPQTKELMHLCMR
QETYLEALSNLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWVMYSNEEAGSDGSVGIIFKN
GDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLSTGDRTGLIEVVLHSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRENGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTSNSEKFERFRGYC
ERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDTQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt   +upstreamnt  +downstreamnt
atgccccctggggttgactgccccatggaattctggaccaaggaggagaatcagagtgtg
gccgttgacttcctgttgcccaccggggtctatctgaacttccctgtgtcccggaatgcc
aacctcagcaccatcaagaaggtgttgtggcaccgagcccagtatgagccactcttccac
atgctcagcgaccccgaggcctatgtgttcacctgcgtcaaccagaccgcagagcagcag
gaactggaggacgaacagcggcggctctgcgacatccagcccttcctgccagtgctgcgt
ctggtggcccgagagggggacagggtgaagaagctggtcaactcacagatcagcctcctc
atcggcaaaggcctccatgagttcgactccctgcatgaccccgaagtgaatgcctttcgc
agcaagatgcgccagttctgcgaggaggcggccgcccgccggcagcagctgggctgggag
gcctggcttcagtacagcttccctctgcagctggagccctcggcccggagctggggggcc
ggcaccgtgcgggtccccacccgggccctcctggtcaacgtcaagtttgagggcagcgag
gagagcttcaccttccaggtgtccaccaaggacgtaccactggcgctgatggcgtgtgcg
ctccggaagaaggccactgtgttccggcagcccctggtggagcagcctgaggactacacg
ctgcaggtgaacggaaagcacgaatacctgtacggcagctaccccctgtaccagttccag
tacatctgcagctgcctgcacagcgggctgaccccccacctgaccatggtgcactcctcg
tccatcctggccatgcgggacgagcagagcgaccctgccccccaagtccagaaaccacgc
accaaaccaccccccattcccatgaagaagccttcttctctgtccctgtggtccctggag
cagcctttccgcgtggagctgattcagggcagcaaagtgaatgccgatgagcggatgaag
ctcgtggtgcaggctgggctcttccacggcaacgagacgctgtgcaagacggtgtccagc
tcggaggtgagcgtgtgctcggagcccgtgtggaaacagcggctggagttcgacatcaac
atctgcgacctgcctcgcatggcccgtctctgctttgcactttacgccgtgatcgagaag
gccaagaaggctcgctccaccaagaagaagtccaagaaggcggactgccccatcgcctgg
gccaacctcatgctgttcgactacaaggaccagctcaagaccggggaatgctgcctgtac
atgtggccgtctgtcccagacgagaaaggggagctgctgaaccccacgggaacagtgcgg
agtaaccccaacacggagagcgctgcggccctcgtcatctgcctccctgaggtggccccc
taccctgtgtactaccccaccctggacaagattctggagctcgggcggcacggggagcac
gggcgcttcagtgaggaggagcagctgcagctgcgggaaatcctggagcggcgggggtcc
ggggagctgtatgagcatgagaaggacctggtgtggaagatgcggcacgaggtccaggag
cgcttccccgaggcgctggcccgcctgctgctggtcaccaagtggaacaagcacgaggat
gtggcccagatgctctacctgctgtgctcctggcccgagctgcctgtcctgagcgccctg
gagctgctggacttcagcttccccgaccgccatgtgggctccttcgccatcaagtctctg
cggaagctgacggacgatgagcttttccagtacctgctgcagctggtgcaggtgctcaag
tacgaatcctacctcgactgcgagctgaccaagttcctgctggaccgggccctggccaac
cgcaagatcggccacttcctcttctggcatctccgctccgagatgcatgtgccctccgtg
gctctgcgctttggcctcatcatggaagcctactgcaggggcagcacccaccacatgaag
gtgctgatgaagcagggggaggcactgagcaagctgaaggccctgagtgactttgtcaaa
gtgagctcccagaagaccaccaagccccagaccaaggagctgatgcacctgtgcatgcgc
caggagacctacctggaggccctgtccaacctgcagtccccgctggaccccagcacgctg
ctggctgaagtctgcgtggagcagtgcaccttcatggactccaagatgaagcccctgtgg
gtgatgtacagcaatgaggaggcagggagtgacggcagcgtgggcatcatctttaagaac
ggggacgacctccgccaggacatgctgactctgcagatgatccagctcatggatgttctg
tggaagcaggaaggactggacctgaggatgaccccctatggctgcctctccacgggggac
cgcacaggcctcatcgaggtggtgcttcactcagacaccatcgccaacatccagctcaac
aagagcaacatggcggccacagcggccttcaacaaggatgccctgctcaactggctcaag
tccaagaaccctggggaggctttggatcgagccatcgaggagtttaccctctcttgcgcc
ggctactgcgtggccacttacgtgctaggcatcggtgatcggcacagcgacaacatcatg
atccgcgagaatgggcagctgttccacattgattttggccactttctggggaatttcaag
accaagtttggaatcaaccgtgagcgagtcccattcatcctcacgtatgactttgtgcac
gtgatccagcaggggaaaacgagtaacagtgagaaatttgaaagattccggggttactgt
gagcgagcctacaccatcctgcggcgtcacgggctgctcttccttcacctcttcgccctg
atgcgggccgccggcctgccggagctcagctgctccaaagacacccagtatctcaaggac
tccctggcgttggggaagacagaggaggaggctctaaagcacttccgggtgaagtttaat
gaagccctccgggagagctggaagaccaaagtgaactggctggcccacaatgtgtccaaa
gataacaggcaataa

DBGET integrated database retrieval system