KEGG   Odobenus rosmarus divergens (Pacific walrus): 101370467
Entry
101370467         CDS       T05148                                 

Definition
(RefSeq) uncharacterized protein LOC101370467
  KO
K06856  immunoglobulin heavy chain
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04020  Calcium signaling pathway
oro04064  NF-kappa B signaling pathway
oro04072  Phospholipase D signaling pathway
oro04145  Phagosome
oro04151  PI3K-Akt signaling pathway
oro04613  Neutrophil extracellular trap formation
oro04640  Hematopoietic cell lineage
oro04650  Natural killer cell mediated cytotoxicity
oro04662  B cell receptor signaling pathway
oro04664  Fc epsilon RI signaling pathway
oro04666  Fc gamma R-mediated phagocytosis
oro04672  Intestinal immune network for IgA production
oro05135  Yersinia infection
oro05140  Leishmaniasis
oro05143  African trypanosomiasis
oro05146  Amoebiasis
oro05150  Staphylococcus aureus infection
oro05152  Tuberculosis
oro05169  Epstein-Barr virus infection
oro05171  Coronavirus disease - COVID-19
oro05202  Transcriptional misregulation in cancer
oro05310  Asthma
oro05320  Autoimmune thyroid disease
oro05322  Systemic lupus erythematosus
oro05323  Rheumatoid arthritis
oro05330  Allograft rejection
oro05340  Primary immunodeficiency
oro05414  Dilated cardiomyopathy
oro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101370467
   04020 Calcium signaling pathway
    101370467
   04072 Phospholipase D signaling pathway
    101370467
   04151 PI3K-Akt signaling pathway
    101370467
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101370467
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101370467
   04613 Neutrophil extracellular trap formation
    101370467
   04650 Natural killer cell mediated cytotoxicity
    101370467
   04662 B cell receptor signaling pathway
    101370467
   04664 Fc epsilon RI signaling pathway
    101370467
   04666 Fc gamma R-mediated phagocytosis
    101370467
   04672 Intestinal immune network for IgA production
    101370467
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101370467
  09163 Immune disease
   05310 Asthma
    101370467
   05322 Systemic lupus erythematosus
    101370467
   05323 Rheumatoid arthritis
    101370467
   05320 Autoimmune thyroid disease
    101370467
   05330 Allograft rejection
    101370467
   05340 Primary immunodeficiency
    101370467
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    101370467
   05416 Viral myocarditis
    101370467
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101370467
   05150 Staphylococcus aureus infection
    101370467
   05152 Tuberculosis
    101370467
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101370467
   05169 Epstein-Barr virus infection
    101370467
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101370467
   05140 Leishmaniasis
    101370467
   05143 African trypanosomiasis
    101370467
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oro04131]
    101370467
Membrane trafficking [BR:oro04131]
 Endocytosis
  Phagocytosis
   Opsonins
    101370467
SSDB
Motif
Pfam: V-set Ig_3
Other DBs
NCBI-GeneID: 101370467
NCBI-ProteinID: XP_004413068
UniProt: A0A2U3WUF6
LinkDB
Position
Unknown
AA seq 276 aa
MEFALGWVFLVTLLKGVQSEVQLVESGGDLVKPGGPLRLSCAASGFTFSSYYMHWVRQAP
GKGLQWVAAISSGGSTYYTDSVKGRFTISKDNGKNTLYLQMNSLRAEDTAVYYCASDTVR
GLQCEPRHKPHCWVFLVALLKGVQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSSYCMS
WVRQAPGKGLQWVAGISSSGSSTYYADSVKGRFTISKDNGKNTLYLQMNSLGAEDTAVYY
CASDTVRGTQCEPRHKPPCRRGSGPPGGAHYSPFCL
NT seq 831 nt   +upstreamnt  +downstreamnt
atggagtttgcacttggctgggttttccttgttactcttttaaaaggtgtccagtctgag
gtgcagctggtggagtctgggggagacctggtgaagcctggagggcccctgagactctct
tgtgcagcctctggattcaccttcagcagctactacatgcactgggtccgccaggctcca
gggaaggggctacagtgggtcgcagctattagcagtggtggtagcacatattacacagac
tctgtgaagggccgattcaccatctccaaagacaacggcaagaacacactgtatctgcag
atgaacagcctgagagccgaggacacggccgtgtattactgtgccagtgacacagtgagg
ggacttcagtgtgagcccagacacaaacctcactgctgggttttccttgttgctctttta
aaaggtgtccagtgtgaggtgcagctggtggagtctgggggagacctggtgaagcctggg
gggtccctgagactctcctgtgcagcctctggattcaccttcagtagctattgcatgagc
tgggtccgccaggctccagggaaggggctgcagtgggtcgcaggtattagcagtagtgga
agtagcacatactacgcagactctgtgaagggccgattcaccatctccaaagacaacggc
aagaacacgctgtatctgcagatgaacagcctaggagccgaggacacggccgtgtattac
tgtgccagtgacactgtgaggggaactcagtgtgagcccagacacaaacctccctgtaga
aggggatctggaccaccagggggtgcacactactcaccattttgtctttaa

DBGET integrated database retrieval system