KEGG   Odobenus rosmarus divergens (Pacific walrus): 101370584Help
Entry
101370584         CDS       T05148                                 

Gene name
GYS1
Definition
(RefSeq) glycogen [starch] synthase, muscle isoform X1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00500  Starch and sucrose metabolism
oro01100  Metabolic pathways
oro04151  PI3K-Akt signaling pathway
oro04152  AMPK signaling pathway
oro04910  Insulin signaling pathway
oro04922  Glucagon signaling pathway
oro04931  Insulin resistance
Module
oro_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101370584 (GYS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101370584 (GYS1)
   04152 AMPK signaling pathway
    101370584 (GYS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101370584 (GYS1)
   04922 Glucagon signaling pathway
    101370584 (GYS1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    101370584 (GYS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:oro01003]
    101370584 (GYS1)
Enzymes [BR:oro01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     101370584 (GYS1)
Glycosyltransferases [BR:oro01003]
 Polysaccharide
  Storage polysaccharide
   101370584 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 101370584
NCBI-ProteinID: XP_004415141
UniProt: A0A2U3WZK8
LinkDB All DBs
Position
Unknown
AA seq 736 aa AA seqDB search
MPLSRTLSMSSLPGLEDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPALKKTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQNEKPHVVAHFHE
WLAGIGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYHR
YCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSK
ARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQT
VVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKMLD
KEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPEF
LSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEH
IADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYL
GRYYMSARHMALAKAFPEHFTYEPHEADATQGYRYPRPASVPPSPSLSRHSSPHQSEDEE
EPRDGPPDVDEERYDEDEEAAKDRRNIRAPEWPRRASCASSTGGSKRSSVDTAPSSSLST
PSEPLSPASSLGEERN
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaagtcgcactttgtccatgtcctccctgccgggactggaggattgggaggat
gaattcgacctggagaacacagtgctcttcgaggtggcctgggaggtggccaacaaggtg
ggaggcatctacacggtgctgcagacgaaggcgaaggtgacaggggatgagtggggtgac
aactactacctggtgggaccttacacggagcagggtgtgaggacccaggtggaactgctc
gagcccccaaccccggccctgaagaagacactggactccatgaacagcaaaggctgcaag
gtgtacttcggtcgctggctgatcgaggggggccccctggtggtgctcctggacgtgggg
gcctcagcctgggccctggagcgctggaagggggagctctgggacacctgcaacatcggg
gtgccctggtacgaccgtgaggccaacgacgctgtcctttttggcttcctcaccacctgg
ttcctgggtgagttcctggcccagaacgagaagccacatgtggttgcacacttccacgag
tggttggcgggcattggactctgcctctgccgggcccggcggctgcctgtagctacaatc
ttcaccacccatgccacgctcctgggacgatacctgtgtgcaggtgccgtggacttctac
aacaacctggagaatttcaatgtggacaaggaagcaggtgagaggcaaatctatcaccgc
tactgcatggagcgggcagcagcccactgcgctcacgtctttactactgtgtcccagatc
actgccatcgaggctcagcacctactcaagaggaaaccagatatcgtgacccccaatggg
ctgaatgtgaagaagttctccgccatgcatgagttccagaacctccatgctcagagcaag
gctcgaatccaggagtttgtgcggggccatttttatgggcacctggacttcaacttggac
aagaccttgtatttctttatcgctggccgctacgagttctctaacaagggggccgacgtc
ttcctagaggccttggcccggctcaactatctgctcagagtaaacggcagtgagcagaca
gtggtcgccttcttcatcatgccagctcggaccaacaatttcaacgtggaaaccctcaag
ggccaggctgtgcgcaagcagctctgggatacggccaacaccgtgaaagagaagtttgga
aggaagctttacgagtccttgctggtggggagcctcccggacatgaacaagatgctggat
aaggaggacttcaccatgatgaagagagccatctttgctacgcagcggcagtctttcccc
cccgtgtgcacccacaacatgctggacgactcctcggaccctatcctgaccaccatccgc
cgaattgggctcttcaatagtagtgctgacagggtcaaggtgattttccatccagagttc
ctctcctccaccagccctctgctccccgtggattatgaggaatttgtccgtggctgccat
cttggggtcttcccctcctactatgagccttggggctacacgccggctgagtgcacggtt
atgggcatccccagtatctccaccaacctctccggcttcggctgcttcatggaggaacac
attgcagacccctcagcttacggcatctacattctggaccggcggttccgcagtctggat
gattcctgctcgcagctcacctccttcctctacagcttctgccagcagagccggcggcag
cgcatcatccagcgaaaccgcacggagcgcctctcagaccttctggactggaaataccta
ggccggtactatatgtctgcacgccacatggcgctggccaaggcctttccggaacacttc
acctatgagccccacgaggctgacgcgacccagggctaccgctacccacggccggcctca
gtgccaccatcgccctcgctgtcgcgacactcaagcccgcaccagagtgaggatgaggag
gagccccgggatgggccgcctgacgtagacgaggagcgctacgacgaggacgaggaggca
gccaaggaccggcgcaacatccgcgcccccgagtggccgcgccgcgcctcctgcgcctct
tccaccggggggagcaagcgcagctcggtggacacggcgccctccagctcgctcagcact
cccagcgagcccctcagccctgccagctccctgggcgaggagcgcaactaa

DBGET integrated database retrieval system