KEGG   Odobenus rosmarus divergens (Pacific walrus): 101370739
Entry
101370739         CDS       T05148                                 

Gene name
TFRC
Definition
(RefSeq) transferrin receptor protein 1
  KO
K06503  transferrin receptor
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04066  HIF-1 signaling pathway
oro04144  Endocytosis
oro04145  Phagosome
oro04216  Ferroptosis
oro04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101370739 (TFRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101370739 (TFRC)
   04145 Phagosome
    101370739 (TFRC)
  09143 Cell growth and death
   04216 Ferroptosis
    101370739 (TFRC)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101370739 (TFRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:oro01002]
    101370739 (TFRC)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101370739 (TFRC)
   04090 CD molecules [BR:oro04090]
    101370739 (TFRC)
Peptidases and inhibitors [BR:oro01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   101370739 (TFRC)
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101370739 (TFRC)
  Exosomal proteins of colorectal cancer cells
   101370739 (TFRC)
CD molecules [BR:oro04090]
 Proteins
  101370739 (TFRC)
SSDB
Motif
Pfam: Peptidase_M28 PA TFR_dimer
Other DBs
NCBI-GeneID: 101370739
NCBI-ProteinID: XP_012416340
UniProt: A0A2U3ZBH2
LinkDB
Position
Unknown
AA seq 770 aa
MMDQARSAFSTLFGGEPLSYTRFSLARQVDGDNSHVEMKLAADEEENVDNNVRGNHASVT
KPKRLNGFMCYGTIAVVLFFLIGFMIGYLGYCKRVEPKAECERPSGTESLGIEGTEPSET
EEYFPETPSRLFWADLKTMLSKRLSNTNFLTTIRLLNENSYVPREAGSQKDESLAFFIEN
QFRAFLLSKVWRDEHFIKIQVKSSSAQNSVTIVGTDSGVVYLVESPEGYVAYSKAATVTG
RLVHANFGTKKDFENLNSPVNGSLVIVRAGKITFAEKVANAQSFNAIGVLIYMDQSRFPI
VNAEIPVFGHAHLGTGDPYTPGFPSFNHTQFPPSQSSGLPSIPVQTISRAAAEKLFENME
GDCPSAWEIDSSCRLETSQNRNVKLTVNNVLKEIRIFNVFGVIKGFEEPDRYVVIGAQRD
AWGPGAAKSSVGTALLLELARIFSDMVLKDGFRPSRSIVFASWSAGDFGAIGATEWLEGY
LSSLHLKAFTYINLDKAILGTNNFKVSASPLLYSLIEKTMKDVKHPVTKQSLYRDSNWMN
KVEEFSWDNAAFPFLAYSGIPAVSFCFCENTDYPYLGTTMDIYEKLKQKIPQLNEMALGA
AEVAGQLIMKLTYDLELNLNYEMYNDKILAFVKDMNRFRADIKEMGLNLQWLYSARGDFF
RATSRLTTDYKNAERTNRYIMREINDRIMKVEYHFLSPYVSPRDSPFRHIFWGSGSHTLS
ALLEHLKLRQKNNSAFNETLLRNQLALATWTIQGAANALSGDIWDIDNEL
NT seq 2313 nt   +upstreamnt  +downstreamnt
atgatggatcaagccagatcagcattctctaccttgtttggtggagaaccattgtcctat
acccggtttagtctggcacggcaagtagatggtgataacagtcatgtggagatgaaacta
gctgcagatgaagaagaaaatgttgacaataacgtgaggggtaatcatgccagtgtcaca
aaaccaaaaaggcttaatggatttatgtgctatgggactattgctgtagtcctctttttc
ttgattggatttatgattggttacttgggctattgtaaacgtgtagaaccaaaagctgaa
tgtgagagaccatcaggaacggagtctctggggatagagggaacagaaccttcagaaaca
gaagagtacttccctgaaacaccttctcgcttattttgggcggacctcaaaacaatgttg
tcaaagagactgagtaacacaaacttcctcaccaccatcaggctgctgaatgaaaattcg
tatgtccctcgtgaggcaggatctcaaaaagacgaaagccttgcttttttcattgagaat
cagttccgtgcatttctgcttagcaaagtctggcgtgatgaacattttattaagattcag
gtcaaaagcagcagtgctcaaaactcggtgaccatagtgggcacggacagtggcgtggta
tacctggtggagagtcctgagggttacgtggcatacagtaaggcagcgacagttactggt
agactggtccatgctaattttggcaccaaaaaagactttgagaatttaaattctcctgtg
aatggatctttagtgatcgttagagcagggaaaatcacttttgctgaaaaggttgcaaat
gctcaaagtttcaatgcaattggtgtcttgatatacatggatcagtctagatttcccatt
gttaatgcagagattccagtctttggacatgctcacctgggaacaggtgacccgtacaca
cctggattcccttctttcaatcacactcagtttccgccatctcagtcatcaggattgccc
agcattcctgtccaaacaatttccagagctgctgcagaaaagttgtttgaaaatatggaa
ggagactgtccttctgcctgggaaatagactcctcgtgcaggctggagacttcccagaac
aggaatgtgaagctcactgtgaacaatgtgctgaaagagataagaatttttaacgttttt
ggagttattaaaggttttgaggaacctgatcgctatgttgtaataggggctcagagggat
gcctggggtcctggagctgcaaagtctagcgtaggaacagctctcctattggaacttgcc
cggatattttctgatatggtcttaaaagatggctttagacccagcagaagcattgtcttt
gccagctggagtgctggcgactttggagcaattggtgccactgaatggctagagggatac
ctttcctccctgcatttaaaggctttcacgtacattaatctggataaagctattcttggt
accaacaacttcaaggtttcggccagcccactgttgtattcgcttattgagaaaacgatg
aaagatgtgaaacatccggttactaagcagtctctttatcgggacagcaactggatgaac
aaagtagaggaattttcttgggataatgctgctttccctttccttgcgtattctggaatc
ccagcagtttctttctgtttttgtgagaatacagattatccttatttgggtactaccatg
gatatctatgagaaactgaaacagaaaattcctcagttgaatgaaatggcacttggagca
gcagaagtagctggtcagcttataatgaaacttacttatgatcttgaattgaacctgaac
tatgagatgtataatgacaaaatacttgcatttgtgaaggatatgaaccgattcagagca
gacataaaggagatgggtctgaatctacaatggctgtattctgctcgtggagactttttc
cgagccacctccagactaacaacagattataagaacgcagagagaacaaacagatatatc
atgagggagatcaatgaccgtatcatgaaagtggaatatcacttcctctcaccctacgta
tctccgagagattctcctttccgacacatcttctggggctctggctctcacactctgtca
gctttactagagcatttgaagctgcgtcagaaaaataacagtgcttttaatgaaacactg
ctgagaaaccagttggctctagcaacttggactattcaaggagctgcaaatgccctttct
ggtgacatatgggacattgacaatgagctttaa

DBGET integrated database retrieval system