KEGG   Odobenus rosmarus divergens (Pacific walrus): 101370816
Entry
101370816         CDS       T05148                                 

Gene name
CD44
Definition
(RefSeq) CD44 antigen
  KO
K06256  CD44 antigen
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04512  ECM-receptor interaction
oro04640  Hematopoietic cell lineage
oro05169  Epstein-Barr virus infection
oro05205  Proteoglycans in cancer
oro05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101370816 (CD44)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101370816 (CD44)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    101370816 (CD44)
   05205 Proteoglycans in cancer
    101370816 (CD44)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101370816 (CD44)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101370816 (CD44)
   04090 CD molecules [BR:oro04090]
    101370816 (CD44)
   00535 Proteoglycans [BR:oro00535]
    101370816 (CD44)
   00536 Glycosaminoglycan binding proteins [BR:oro00536]
    101370816 (CD44)
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101370816 (CD44)
  Exosomal proteins of other body fluids (saliva and urine)
   101370816 (CD44)
  Exosomal proteins of colorectal cancer cells
   101370816 (CD44)
  Exosomal proteins of bladder cancer cells
   101370816 (CD44)
CD molecules [BR:oro04090]
 Proteins
  101370816 (CD44)
Proteoglycans [BR:oro00535]
 Cell surface proteoglycans
  Others
   101370816 (CD44)
Glycosaminoglycan binding proteins [BR:oro00536]
 Hyaluronan
  Cell surface receptors
   101370816 (CD44)
SSDB
Motif
Pfam: Xlink
Other DBs
NCBI-GeneID: 101370816
NCBI-ProteinID: XP_004406132
UniProt: A0A2U3WCC7
LinkDB
Position
Unknown
AA seq 363 aa
MDKFWGRLAWGLCLLQLSLAQIDLNITCRYAGVFHVEKNGRYSISRTEAADLCKAFNSTL
PTMAQMEKALSVGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFN
ASAPPEEDCTSVTHLPNAFEGPITITIVNRDGTRYSQTGEYRTNPEDINPSSPTDDDVSS
GSSSERSTSGGYNIFHTHLPTVYPTQDQDSTGVSDNPEHTPITKDQDSSVHPSGTSHTTH
GSESAGHSSGSQEGRANTTSGPVRKPQIPEWLIILASLLALALILAVCIAVNSRRRCGQK
KKLVINNGNGAVGDRKPSGINGEASKSQEMVHLVNKEPSETPDQYMTADETRNLQNVDMK
IGM
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggacaagttttgggggcgcttagcctggggactgtgcctcctgcagctgagcctggcg
cagatcgatttgaatataacctgccgatacgcaggtgtgttccacgtggagaaaaatggt
cgctacagcatctccaggacagaggccgctgacctctgcaaggctttcaacagcaccctg
cccaccatggcccagatggagaaagccctgagcgtggggtttgagacctgcaggtacggg
ttcatagaagggcatgtggtgatcccccgtattcaccccaactccatctgtgctgcaaac
aacacaggggtgtacatcctcacatccaacacctcgcagtacgacacgtactgcttcaat
gcctcagctccacccgaagaagattgcacatcggtcacacacctgcccaatgcctttgaa
ggaccaattaccataaccattgtcaaccgcgatggcacccgctacagccagacaggtgaa
tacagaacgaaccctgaagacatcaaccccagcagccccactgatgatgatgtgagcagc
ggatcctccagcgagaggagcacttcgggaggctacaacatcttccacacccaccttcca
actgtatacccgacccaggaccaagacagtacgggggtgtctgacaacccagagcatacc
cccattaccaaagaccaagactcatcagttcaccccagtggaacgtcccataccactcat
ggatcagaatcagctggccactcaagtgggagtcaagaaggtagggcaaacacgacctcg
ggtcctgtgcggaaacctcaaattccagaatggctcatcatcttggcctccctcctggcc
ttggctttgattcttgccgtttgcattgctgtcaatagtcgaagaaggtgtgggcagaag
aagaagctggtgatcaacaatggcaacggagcagtgggggaccggaagccaagcggaatc
aacggagaggccagcaagtctcaggagatggtgcacttggtgaacaaggagccctcagag
actccagatcagtatatgacagccgacgagacgcggaacctgcagaatgtggacatgaag
attgggatgtaa

DBGET integrated database retrieval system