KEGG   Odobenus rosmarus divergens (Pacific walrus): 101370982
Entry
101370982         CDS       T05148                                 

Gene name
CD22
Definition
(RefSeq) B-cell receptor CD22 isoform X1
  KO
K06467  CD22 antigen
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04514  Cell adhesion molecules
oro04640  Hematopoietic cell lineage
oro04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101370982 (CD22)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101370982 (CD22)
   04662 B cell receptor signaling pathway
    101370982 (CD22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:oro04090]
    101370982 (CD22)
   04091 Lectins [BR:oro04091]
    101370982 (CD22)
CD molecules [BR:oro04090]
 Proteins
  101370982 (CD22)
Lectins [BR:oro04091]
 I-type lectins (Siglecs)
  101370982 (CD22)
SSDB
Motif
Pfam: Ig_3 Ig_2 ig I-set V-set Ig_4 C2-set_2 C1-set Ig_6 ICAM_N 5-FTHF_cyc-lig
Other DBs
NCBI-GeneID: 101370982
NCBI-ProteinID: XP_004417153
UniProt: A0A2U3X4E6
LinkDB
Position
Unknown
AA seq 850 aa
MHLLGPSLLLLVWWVPEYLAFSDSTKWSFEHPHTLYSWDGACVWIPCQYTAPLRRDQLDN
LILYSNYEYDDTTKNFKGPILYEKTKSLGDDHTPERVQFLGDQRSNCTISINPVLEKDNG
WLGLRLTTKAGKWMEKIDLNVSKTPLSPHIQLPPEIQESQEVTLTCLLNFSCPGYQIQLQ
WSVEEPAVTLTSLTTKTVSTQSKLTFQPQWTHHGKNLTCQLWDPKVERILSEETVLLDVK
HVPKLKIEVSPEGANVTEGESVTMTCQVISSNPEFRSIAWLKDGTRLREQETLTLTLSSV
TRKMSGEYQCEAFNDLGSGQSDEVFLQVYYAPEPSRVEIFSSPAKEGNKVEMTCTSLANP
PPTNYTWYHNELKVPGMTNKTFQIPEVFFSHAGQYSCLAENRLGPGPIGQETELDVQYAP
KEVTTVIQNPTRIREGDTVTLSCNYSSSNPRVTRYEWNLQGSWKEQSPGVLIIQKVAWDA
RPIACAACNQWCSWAPSVNLDVQHAPKDVRVQQISPPSEIHSGHRVLLGCNFSSSRPRDV
RFFWKRNGIFLKEGKELSFDSISPEDAGNYNCFINNSIGQTMSEARRLQVLYAPRMLRVA
ISPKDQVMEGKKAVLTCESDANPPIFQYTWFDWKNQNLHHYDQMLRLDPVKIQHSGAYWC
EATNQLGRVQSPPSTLTVYYSPETIGRRVAVGVGFCLATLLLVFWGVKLQRSWKRIRSQQ
GLQESSSGQSFFVRKQKVRRAPLSEDPHSLGCYNPVMEDAISYATLRFPFGETDTPRTGD
AGTLETERPSPNRDDTVTYSVLQKCREGDYENVLPDSPEDEGIHYSELVHLGLGKRPVAQ
EAVEYVTLKH
NT seq 2553 nt   +upstreamnt  +downstreamnt
atgcatctcctcggcccctcgctcctgctccttgtgtggtgggttccagaatacttggcc
ttctctgactcaactaaatggagctttgagcacccccacactctctacagctgggatggg
gcctgcgtctggattccctgtcaatacacagctccactgcgtagagatcagctggacaac
ctgatcttgtacagcaactatgaatatgacgacaccaccaagaacttcaaggggcccatt
ctctatgagaaaacaaagtctttgggggatgaccataccccagagagggttcagttcctg
ggagaccaaagatccaactgcaccataagcattaaccctgtgttggaaaaagacaatggc
tggctggggctgaggttgacaacgaaggctggcaaatggatggagaaaatagacctcaac
gtctctaagacacccctgtcacctcacattcagctccctccagaaatccaggagtcccag
gaagtcactctgacttgcttgctgaatttctcctgccctgggtaccagatccagctgcag
tggtccgtggaggagcctgccgtcaccttgacctccctgaccaccaagactgtctccacc
cagagcaagctcaccttccagccgcagtggacgcaccacggcaagaatctgacctgccaa
ctctgggaccccaaagtagagcggatcctctccgaggaaacggtgttgctggatgtgaag
catgtcccaaagttgaagattgaggtcagtcccgaaggagccaatgtaacagagggagag
tctgtgaccatgacctgccaggtcatcagcagcaacccagagttccggagtatagcctgg
ctcaaggatgggacccggctgagggagcaggagacactcacgttaactctgtcctctgtg
accaggaagatgagtggagagtaccagtgtgaggccttcaatgatctaggctcaggacag
tcggatgaagtgttcctccaagtgtactatgctccggaaccttccagggttgagatcttc
tcctcgccagctaaggagggaaataaagtagagatgacttgtacgtcactggccaatcct
cctccaaccaattacacctggtatcacaatgaattaaaagtgccaggaatgacaaacaag
accttccagatcccagaggtcttcttcagccatgctgggcagtattcctgcttggcagaa
aacagacttggtcctggaccaattggccaggagactgagttagatgtccaatatgcaccc
aaggaggtaaccacagtgattcaaaaccccacacggattcgagaaggagacactgtgacc
ctgtcatgtaactacagttccagtaatcccagagttacccgatatgaatggaacctccaa
ggctcctggaaggaacaatcacccggggtgctgataattcaaaaagttgcctgggacgcc
aggccgattgcctgtgcagcctgtaaccagtggtgttcatgggctccctctgtcaacttg
gatgtccagcatgcccccaaggatgtcagggtccagcagatcagccccccttctgagatt
cactccgggcaccgagtcctccttggatgtaacttctcaagtagccgccccagagatgtc
cgcttcttctggaagagaaatggaatctttctgaaggaaggaaaagaactgagctttgac
tccatctctccagaagatgccggcaattacaactgcttcatcaacaactccataggacag
accatgtctgaggccaggaggctccaagtgctgtatgcaccaaggatgctgcgtgtggcc
atcagcccaaaggaccaagtgatggaggggaagaaggcagtcctgacatgtgagagcgat
gccaaccctcccatcttccagtacacctggtttgactggaaaaaccagaacctccaccat
tatgatcagatgctgagattggatcccgtgaagatccagcactcaggcgcctattggtgt
gaggcaaccaaccagctgggcagggtccagtcgccccccagcaccctcactgtctactac
agccccgagaccatcggcaggcgagtggctgtgggagtggggttctgcctggccacccta
ctcctggtgttctggggagtcaaacttcagcgaagctggaagaggatacggagccagcag
gggctccaggaaagttccagtgggcagagcttctttgtgaggaagcaaaaggtcagaagg
gccccgctctccgaagacccccactccctggggtgctacaatccggtgatggaagatgcc
atcagttacgccaccttgcgctttcctttcggcgagactgacacaccaagaactggagat
gcagggaccctggagacagagagaccttctccaaacagggacgacaccgtcacttactct
gtcttgcagaagtgtcgagagggcgactatgagaacgtgcttccagacagtccagaagat
gaggggatacattactcagagctggttcatcttgggttggggaagcggcctgtggcccag
gaagccgtggaatacgtgaccctcaagcactga

DBGET integrated database retrieval system