KEGG   Odobenus rosmarus divergens (Pacific walrus): 101371210
Entry
101371210         CDS       T05148                                 

Gene name
CD7
Definition
(RefSeq) T-cell antigen CD7
  KO
K06457  T-cell surface glycoprotein CD7
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:oro00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101371210 (CD7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:oro04090]
    101371210 (CD7)
CD molecules [BR:oro04090]
 Proteins
  101371210 (CD7)
SSDB
Motif
Pfam: V-set Ig_3 Ig_2 ig I-set RestrictionSfiI HtaA
Other DBs
NCBI-GeneID: 101371210
NCBI-ProteinID: XP_004404512
UniProt: A0A2U3W8C8
LinkDB
Position
Unknown
AA seq 209 aa
MAPELPWLPVRLILACTLLRALATQEVRQFPPYTIVPEGGSISITCSMSGPLSGVFLRQR
WPKPTSVIYYEDKKPPTVDERFRGRVAFSGLQHNLTITLSHLQMSDTGAYACQAVLDDMV
WGPDTLVVVTDKVSQEADTCQKAQLISAFPVVLAMSCFFLGLGIGAVCVLRKTQVKKLCC
VEDKNSACIVYEDMSYKGRNRMSTPNEYQ
NT seq 630 nt   +upstreamnt  +downstreamnt
atggccccagagctcccatggctccctgtgcgcctcatactcgcctgtaccctgctcagg
gctctggccacccaagaggtgcggcagttccccccctacacgattgtccccgagggaggc
tccatcagcatcacctgctccatgagcgggcccctgtccggggtcttcctgaggcaaagg
tggccgaagcccaccagtgtgatttactacgaagacaagaagccgcccactgtagatgag
cgcttccgaggtcgcgttgccttctccgggctgcagcacaacctgaccatcaccctgagc
cacctgcagatgtctgacactggagcttatgcctgccaggcggtcctggatgacatggtc
tggggccctgacaccttggtggtggtgacagacaaagtgtcccaggaagcagacacgtgc
cagaaggctcagctgatctctgccttccctgtggtcctggcgatgagctgcttcttcctc
gggctggggataggggcagtgtgtgtgctgaggaagacacaggtcaagaaactgtgctgc
gtggaggataagaactcagcatgtatagtgtacgaggacatgtcctataaaggccgaaac
aggatgtccacccccaacgagtaccagtga

DBGET integrated database retrieval system