KEGG   Odobenus rosmarus divergens (Pacific walrus): 101371532
Entry
101371532         CDS       T05148                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01522  Endocrine resistance
oro04068  FoxO signaling pathway
oro04110  Cell cycle
oro04115  p53 signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04152  AMPK signaling pathway
oro04218  Cellular senescence
oro04310  Wnt signaling pathway
oro04340  Hedgehog signaling pathway
oro04371  Apelin signaling pathway
oro04390  Hippo signaling pathway
oro04510  Focal adhesion
oro04530  Tight junction
oro04630  JAK-STAT signaling pathway
oro04917  Prolactin signaling pathway
oro04919  Thyroid hormone signaling pathway
oro04921  Oxytocin signaling pathway
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro04934  Cushing syndrome
oro05160  Hepatitis C
oro05162  Measles
oro05163  Human cytomegalovirus infection
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05169  Epstein-Barr virus infection
oro05200  Pathways in cancer
oro05203  Viral carcinogenesis
oro05205  Proteoglycans in cancer
oro05206  MicroRNAs in cancer
oro05210  Colorectal cancer
oro05212  Pancreatic cancer
oro05213  Endometrial cancer
oro05214  Glioma
oro05215  Prostate cancer
oro05216  Thyroid cancer
oro05218  Melanoma
oro05219  Bladder cancer
oro05220  Chronic myeloid leukemia
oro05221  Acute myeloid leukemia
oro05222  Small cell lung cancer
oro05223  Non-small cell lung cancer
oro05224  Breast cancer
oro05225  Hepatocellular carcinoma
oro05226  Gastric cancer
oro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101371532 (CCND1)
   04340 Hedgehog signaling pathway
    101371532 (CCND1)
   04390 Hippo signaling pathway
    101371532 (CCND1)
   04371 Apelin signaling pathway
    101371532 (CCND1)
   04630 JAK-STAT signaling pathway
    101371532 (CCND1)
   04068 FoxO signaling pathway
    101371532 (CCND1)
   04151 PI3K-Akt signaling pathway
    101371532 (CCND1)
   04152 AMPK signaling pathway
    101371532 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101371532 (CCND1)
   04115 p53 signaling pathway
    101371532 (CCND1)
   04218 Cellular senescence
    101371532 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101371532 (CCND1)
   04530 Tight junction
    101371532 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    101371532 (CCND1)
   04921 Oxytocin signaling pathway
    101371532 (CCND1)
   04919 Thyroid hormone signaling pathway
    101371532 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101371532 (CCND1)
   05206 MicroRNAs in cancer
    101371532 (CCND1)
   05205 Proteoglycans in cancer
    101371532 (CCND1)
   05203 Viral carcinogenesis
    101371532 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101371532 (CCND1)
   05212 Pancreatic cancer
    101371532 (CCND1)
   05225 Hepatocellular carcinoma
    101371532 (CCND1)
   05226 Gastric cancer
    101371532 (CCND1)
   05214 Glioma
    101371532 (CCND1)
   05216 Thyroid cancer
    101371532 (CCND1)
   05221 Acute myeloid leukemia
    101371532 (CCND1)
   05220 Chronic myeloid leukemia
    101371532 (CCND1)
   05218 Melanoma
    101371532 (CCND1)
   05219 Bladder cancer
    101371532 (CCND1)
   05215 Prostate cancer
    101371532 (CCND1)
   05213 Endometrial cancer
    101371532 (CCND1)
   05224 Breast cancer
    101371532 (CCND1)
   05222 Small cell lung cancer
    101371532 (CCND1)
   05223 Non-small cell lung cancer
    101371532 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101371532 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101371532 (CCND1)
   04934 Cushing syndrome
    101371532 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101371532 (CCND1)
   05162 Measles
    101371532 (CCND1)
   05160 Hepatitis C
    101371532 (CCND1)
   05163 Human cytomegalovirus infection
    101371532 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101371532 (CCND1)
   05169 Epstein-Barr virus infection
    101371532 (CCND1)
   05165 Human papillomavirus infection
    101371532 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101371532 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 101371532
NCBI-ProteinID: XP_004393858
UniProt: A0A2U3VGG3
LinkDB
Position
Unknown
AA seq 295 aa
MAHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEILPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELFLVNKLKWNLAAMTPHDFIEHFLSKMPVAEENRQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLHLGSSSSFLSYHRLTRFLSKVIKCD
ADCLRACQEQIEALLESSLRQAQQQSLDPKAAEEEEEEEEADLACTPTDVRDVNI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggcacaccaactcttatgctgcgaggtggagaccatccgccgggcgtaccccgatgcc
aacctcctcaacgaccgggtgctgcgggccatgctcaaggcggaggagacctgcgcaccc
tccgtgtcctacttcaagtgtgtgcagaaggagatcctgccgtccatgcggaagatcgtg
gccacctggatgctggaggtctgcgaggagcagaagtgcgaggaggaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagccggtgaaaaagagccgcctgcag
ctgctgggggccacctgcatgttcgtggcctcgaagatgaaggagaccatccccctgacg
gccgagaagctgtgcatctacactgacaactccatccggcctgatgagctgctgcaaatg
gagctgttcctggtgaacaaactcaagtggaacctggccgcgatgaccccgcatgatttc
atcgagcacttcctctctaagatgcccgtggcagaggagaacagacagatcatccgcaag
cacgcacagaccttcgtcgccctctgtgccacagacgtgaagttcatttccaacccgccc
tccatggtggcagctgggagtgtggtggccgccgtgcaaggcctgcacctggggagttcc
agcagcttcctgtcctaccaccgcctcactcggttcctctccaaagtgattaagtgtgac
gcggactgtctccgggcgtgccaggagcagatcgaagccctgctggagtccagcctgcgc
caggcccagcagcagagcctggaccccaaggcggcggaggaggaggaggaggaggaggag
gccgacctggcctgcacgcccaccgatgtgcgagacgtgaacatttga

DBGET integrated database retrieval system