KEGG   Odobenus rosmarus divergens (Pacific walrus): 101372059
Entry
101372059         CDS       T05148                                 

Gene name
KIT
Definition
(RefSeq) mast/stem cell growth factor receptor Kit isoform X7
  KO
K05091  proto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04010  MAPK signaling pathway
oro04014  Ras signaling pathway
oro04015  Rap1 signaling pathway
oro04072  Phospholipase D signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04640  Hematopoietic cell lineage
oro04916  Melanogenesis
oro05200  Pathways in cancer
oro05221  Acute myeloid leukemia
oro05224  Breast cancer
oro05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101372059 (KIT)
   04014 Ras signaling pathway
    101372059 (KIT)
   04015 Rap1 signaling pathway
    101372059 (KIT)
   04072 Phospholipase D signaling pathway
    101372059 (KIT)
   04151 PI3K-Akt signaling pathway
    101372059 (KIT)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101372059 (KIT)
  09152 Endocrine system
   04916 Melanogenesis
    101372059 (KIT)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101372059 (KIT)
   05230 Central carbon metabolism in cancer
    101372059 (KIT)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101372059 (KIT)
   05224 Breast cancer
    101372059 (KIT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oro01001]
    101372059 (KIT)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:oro04090]
    101372059 (KIT)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101372059 (KIT)
Protein kinases [BR:oro01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   101372059 (KIT)
CD molecules [BR:oro04090]
 Proteins
  101372059 (KIT)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Ig_6 Ig_4 C2-set_2 APH C1-set Pkinase_fungal
Other DBs
NCBI-GeneID: 101372059
NCBI-ProteinID: XP_004396324
UniProt: A0A2U3VMP4
LinkDB
Position
Unknown
AA seq 972 aa
MRGARGAWDFLCVLLLLFRVQTGSSQPSVSPGELSLPSIHPAKSELIVSVGDEIRLLCTD
PGFVKWTFETPGQLSENTRNEWITEKAEATNTGNYTCTNRDGLSRSIYVFVRDPAQLFLV
DLRLYGKEDNDTLVRCPLTDPEVTNYSLKGCEGKPLPKDLTFVADPKAGITIRHVKREYH
RLCLHCSADQKGKSVLSMKFTLKVRAAIRAVPVVSVSKASSLLREGEEFSVMCSVKDVSS
SVDSMWIKENSQTNAQTQSNSWHQGDFNFVRQERLTISSARVNDSGVFMCYANNTFGSAN
VTTTLEVVDRGFINIFPMMNTTIFVNDGENVDLIVEYEAYPKPEHQQWIYMNRTFTDKWE
DYPKSDNESNIRYVSELHLTRLKGDEGGTYTFQVSNSDVNSSVTFNVYVNTKPEILTHES
LVNGMLQCVVAGFPEPTVDWYFCPGTEQRCSVPIGPMDVQMQNSSVSPSGKLVVQSSIDY
STFKHNGTVECRAYNNVGRSSAFFNFAFKEQIHPHTLFTPLLIGFVIAAGMMCIIVMILT
YKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAFGKVV
EATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGACTVGG
PTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEVALYKNLLHSKESSCNDSTNEYMDM
KPGVSYVVPTKADKRRSARIGSYIERDATPAIMEDDELALDLEDLLSFSYQVAKGMAFLA
SKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPESIFNC
VYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMYDIMK
TCWDADPLKRPTFKQIVQLIEKQISDSTNHIYSNLANCSPHQERPVVDHSVRINSVGSSA
SSTQPLLVHEDV
NT seq 2919 nt   +upstreamnt  +downstreamnt
atgagaggcgctcgcggcgcctgggattttctctgcgtcctgctcctcctgttccgcgtc
cagacaggctcttctcaaccatctgtgagtccaggggaactgtctctaccatccatccac
ccagcaaaatcagagttaatagtcagtgttggcgacgagattaggctgttatgcaccgat
ccaggatttgtcaaatggacttttgagaccccgggtcaattgagtgagaacacacgcaat
gaatggatcacggagaaagccgaggccaccaacacaggcaattacacgtgcaccaacaga
gatggtttaagcaggtccatttatgtgtttgttagagatcctgcgcagcttttcctcgtt
gaccttcgcttgtatgggaaagaagacaatgatacgctggtccgctgtcctctgacagac
ccagaggtgaccaattactccctcaaggggtgtgaggggaagcctcttcccaaggacttg
acgtttgtcgctgatcccaaggctggcatcacgatcagacacgtgaagcgcgagtatcac
cggctctgcttgcactgctctgcagaccagaagggcaagtccgtgctgtcgatgaaattc
accctgaaagtgagggcagccatcagagctgtcccggttgtgtcagtgtccaaagcaagc
tctcttcttagggaaggggaagaattctctgtgatgtgctcggtaaaggatgtgtctagt
tctgtggactccatgtggatcaaggaaaatagtcagactaatgcacagactcagagtaat
agttggcatcagggtgacttcaatttcgtacgtcaggaaagattgactatcagctcagca
agagttaatgattctggagtattcatgtgttacgccaataatactttcggatcagcgaat
gtcacaaccaccttggaagttgtcgatagaggattcattaatatcttccccatgatgaat
actacaatatttgtaaatgatggagagaatgtggatttgattgttgaatatgaggcatat
cccaaacctgagcaccagcagtggatctatatgaacagaaccttcactgataaatgggaa
gattatcccaagtctgacaatgaaagtaatatcagatatgtgagtgagcttcatctaacc
agattaaaaggggacgaaggaggcacttacacatttcaagtgtccaattccgatgtcaat
tcttccgtgacatttaatgtttatgtgaacacaaaaccagaaatcctgactcatgaaagt
ctcgtgaatggcatgctccagtgtgtggtagcgggattcccagagcccacagtagattgg
tatttttgtccaggaactgagcagaggtgttccgttcctattgggccaatggatgtgcag
atgcaaaactcatctgtctcaccgtctggaaagctcgtggttcagagctccattgattat
agcacgttcaagcacaacggcacggtcgagtgtagggcttacaacaatgtgggcaggagt
tctgccttttttaactttgcatttaaagaacaaatccatccccacaccctgttcacacct
ttgctgattggttttgtgatcgcggctggtatgatgtgcattatcgtgatgattcttacc
tacaaatatttacagaaacccatgtatgaagtacagtggaaggttgttgaggagataaat
ggaaacaattacgtttacatagacccaacacaacttccttatgatcataaatgggagttt
cccagaaacaggctgagttttgggaaaactctgggcgccggtgccttcgggaaagtggtt
gaggctactgcatatggcctcattaagtcagatgcggccatgactgtggccgttaagatg
ctcaaaccaagtgcccatttaactgaacgagaggccctgatgtcggagctcaaagtcttg
agttaccttggtaatcacatgaatattgtgaatcttcttggagcatgcaccgttggaggg
cccaccctggtcatcactgaatactgctgctatggtgatcttttgaattttttgcgaaga
aaacgtgattcatttatttgctcaaagcaggaagatcacgctgaagtggcactttataag
aaccttctgcattcaaaggagtcttcttgcaatgatagtactaatgaatacatggacatg
aaacccggagtttcttatgttgtgccaaccaaggcagacaaaaggagatctgcgagaata
ggctcatacatagaaagagatgcgactcccgccatcatggaagatgacgagttggctctg
gacctggaggacttgctgagcttttcttaccaggtggccaagggcatggcattcctcgcc
tcaaagaattgtattcacagagacttggctgctagaaatatcctccttactcatggtcga
atcacaaagatttgtgattttggtctagccagagacatcaagaatgattctaattatgtg
gtcaaaggaaacgctcggctgcctgtgaagtggatggcacctgaaagcattttcaactgt
gtgtacacatttgaaagtgatgtctggtcctatgggatttttctgtgggagctgttctct
ttaggaagcagcccctaccccgggatgccagttgattctaagttctacaagatgatcaag
gaagggttccgaatgctcagccctgagcatgcacctgccgaaatgtatgacatcatgaag
acttgctgggatgctgatcccctaaaaaggccaacgttcaagcagatcgtgcagctcatt
gagaagcagatttcagatagcaccaatcatatttattccaacctagcaaactgcagcccc
caccaggagcgtcctgtggtggaccattctgtgcggatcaactctgtgggcagcagtgca
tcttctacccagcctctgctggttcacgaagatgtctga

DBGET integrated database retrieval system