KEGG   Odobenus rosmarus divergens (Pacific walrus): 101372149
Entry
101372149         CDS       T05148                                 

Gene name
RAF1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase isoform X2
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01521  EGFR tyrosine kinase inhibitor resistance
oro01522  Endocrine resistance
oro04010  MAPK signaling pathway
oro04012  ErbB signaling pathway
oro04014  Ras signaling pathway
oro04015  Rap1 signaling pathway
oro04022  cGMP-PKG signaling pathway
oro04024  cAMP signaling pathway
oro04062  Chemokine signaling pathway
oro04068  FoxO signaling pathway
oro04071  Sphingolipid signaling pathway
oro04072  Phospholipase D signaling pathway
oro04140  Autophagy - animal
oro04150  mTOR signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04210  Apoptosis
oro04218  Cellular senescence
oro04270  Vascular smooth muscle contraction
oro04360  Axon guidance
oro04370  VEGF signaling pathway
oro04371  Apelin signaling pathway
oro04510  Focal adhesion
oro04540  Gap junction
oro04550  Signaling pathways regulating pluripotency of stem cells
oro04613  Neutrophil extracellular trap formation
oro04625  C-type lectin receptor signaling pathway
oro04630  JAK-STAT signaling pathway
oro04650  Natural killer cell mediated cytotoxicity
oro04660  T cell receptor signaling pathway
oro04662  B cell receptor signaling pathway
oro04664  Fc epsilon RI signaling pathway
oro04666  Fc gamma R-mediated phagocytosis
oro04720  Long-term potentiation
oro04722  Neurotrophin signaling pathway
oro04726  Serotonergic synapse
oro04730  Long-term depression
oro04810  Regulation of actin cytoskeleton
oro04910  Insulin signaling pathway
oro04912  GnRH signaling pathway
oro04914  Progesterone-mediated oocyte maturation
oro04915  Estrogen signaling pathway
oro04916  Melanogenesis
oro04917  Prolactin signaling pathway
oro04919  Thyroid hormone signaling pathway
oro04921  Oxytocin signaling pathway
oro04926  Relaxin signaling pathway
oro04928  Parathyroid hormone synthesis, secretion and action
oro04929  GnRH secretion
oro04935  Growth hormone synthesis, secretion and action
oro05010  Alzheimer disease
oro05022  Pathways of neurodegeneration - multiple diseases
oro05034  Alcoholism
oro05132  Salmonella infection
oro05152  Tuberculosis
oro05160  Hepatitis C
oro05161  Hepatitis B
oro05163  Human cytomegalovirus infection
oro05164  Influenza A
oro05165  Human papillomavirus infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05170  Human immunodeficiency virus 1 infection
oro05200  Pathways in cancer
oro05205  Proteoglycans in cancer
oro05206  MicroRNAs in cancer
oro05210  Colorectal cancer
oro05211  Renal cell carcinoma
oro05212  Pancreatic cancer
oro05213  Endometrial cancer
oro05214  Glioma
oro05215  Prostate cancer
oro05218  Melanoma
oro05219  Bladder cancer
oro05220  Chronic myeloid leukemia
oro05221  Acute myeloid leukemia
oro05223  Non-small cell lung cancer
oro05224  Breast cancer
oro05225  Hepatocellular carcinoma
oro05226  Gastric cancer
oro05230  Central carbon metabolism in cancer
oro05231  Choline metabolism in cancer
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101372149 (RAF1)
   04012 ErbB signaling pathway
    101372149 (RAF1)
   04014 Ras signaling pathway
    101372149 (RAF1)
   04015 Rap1 signaling pathway
    101372149 (RAF1)
   04370 VEGF signaling pathway
    101372149 (RAF1)
   04371 Apelin signaling pathway
    101372149 (RAF1)
   04630 JAK-STAT signaling pathway
    101372149 (RAF1)
   04068 FoxO signaling pathway
    101372149 (RAF1)
   04072 Phospholipase D signaling pathway
    101372149 (RAF1)
   04071 Sphingolipid signaling pathway
    101372149 (RAF1)
   04024 cAMP signaling pathway
    101372149 (RAF1)
   04022 cGMP-PKG signaling pathway
    101372149 (RAF1)
   04151 PI3K-Akt signaling pathway
    101372149 (RAF1)
   04150 mTOR signaling pathway
    101372149 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101372149 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    101372149 (RAF1)
   04218 Cellular senescence
    101372149 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101372149 (RAF1)
   04540 Gap junction
    101372149 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    101372149 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101372149 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101372149 (RAF1)
   04625 C-type lectin receptor signaling pathway
    101372149 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    101372149 (RAF1)
   04660 T cell receptor signaling pathway
    101372149 (RAF1)
   04662 B cell receptor signaling pathway
    101372149 (RAF1)
   04664 Fc epsilon RI signaling pathway
    101372149 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    101372149 (RAF1)
   04062 Chemokine signaling pathway
    101372149 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101372149 (RAF1)
   04929 GnRH secretion
    101372149 (RAF1)
   04912 GnRH signaling pathway
    101372149 (RAF1)
   04915 Estrogen signaling pathway
    101372149 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    101372149 (RAF1)
   04917 Prolactin signaling pathway
    101372149 (RAF1)
   04921 Oxytocin signaling pathway
    101372149 (RAF1)
   04926 Relaxin signaling pathway
    101372149 (RAF1)
   04935 Growth hormone synthesis, secretion and action
    101372149 (RAF1)
   04919 Thyroid hormone signaling pathway
    101372149 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    101372149 (RAF1)
   04916 Melanogenesis
    101372149 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101372149 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    101372149 (RAF1)
   04720 Long-term potentiation
    101372149 (RAF1)
   04730 Long-term depression
    101372149 (RAF1)
   04722 Neurotrophin signaling pathway
    101372149 (RAF1)
  09158 Development and regeneration
   04360 Axon guidance
    101372149 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101372149 (RAF1)
   05206 MicroRNAs in cancer
    101372149 (RAF1)
   05205 Proteoglycans in cancer
    101372149 (RAF1)
   05230 Central carbon metabolism in cancer
    101372149 (RAF1)
   05231 Choline metabolism in cancer
    101372149 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101372149 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101372149 (RAF1)
   05212 Pancreatic cancer
    101372149 (RAF1)
   05225 Hepatocellular carcinoma
    101372149 (RAF1)
   05226 Gastric cancer
    101372149 (RAF1)
   05214 Glioma
    101372149 (RAF1)
   05221 Acute myeloid leukemia
    101372149 (RAF1)
   05220 Chronic myeloid leukemia
    101372149 (RAF1)
   05218 Melanoma
    101372149 (RAF1)
   05211 Renal cell carcinoma
    101372149 (RAF1)
   05219 Bladder cancer
    101372149 (RAF1)
   05215 Prostate cancer
    101372149 (RAF1)
   05213 Endometrial cancer
    101372149 (RAF1)
   05224 Breast cancer
    101372149 (RAF1)
   05223 Non-small cell lung cancer
    101372149 (RAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101372149 (RAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    101372149 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    101372149 (RAF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101372149 (RAF1)
   05152 Tuberculosis
    101372149 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101372149 (RAF1)
   05161 Hepatitis B
    101372149 (RAF1)
   05160 Hepatitis C
    101372149 (RAF1)
   05164 Influenza A
    101372149 (RAF1)
   05163 Human cytomegalovirus infection
    101372149 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101372149 (RAF1)
   05165 Human papillomavirus infection
    101372149 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101372149 (RAF1)
   01522 Endocrine resistance
    101372149 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oro01001]
    101372149 (RAF1)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101372149 (RAF1)
Protein kinases [BR:oro01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   101372149 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 101372149
NCBI-ProteinID: XP_004395701
UniProt: A0A2U3VL57
LinkDB
Position
Unknown
AA seq 648 aa
MEHIQGAWKTISNGFGFKDTVFDGPSCISPTIVQPFGFQRRASDDGKLTDSSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTIGDSGVPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTF
NSSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHSESASPSALSSSPNNL
SPTGWSQPKTPVPAQRERAPGSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSF
GTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYE
LMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFP
QILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggagcacatacagggggcctggaagacgatcagcaacggttttggattcaaagacaca
gtgtttgacggccccagctgcatctcccctacaatagttcagccatttggctttcagcgt
cgagcatcagatgatggcaaacttacggactcgtctaagacaagcaacactatccgtgtt
ttcttgccaaacaagcaaagaacggtggtcaatgtgcgaaatggaatgagcttgcacgat
tgccttatgaaagcactcaaggtgaggggcctacagccggagtgctgtgccgtgttcaga
cttctccatgaacataaaggtaaaaaagcacgtttagattggaatactgatgccgcctcg
ctgattggagaagaacttcaagtagatttcctggatcatgttcccctcacaacacacaac
tttgcacgaaagaccttcctgaagcttgccttctgtgacatctgtcagaagttcctgcta
aatggatttcgttgtcagacttgtggctacaaatttcacgagcactgtagcaccaaagta
cctactatgtgtgtggactggagtaatatcagacagctcttattgtttccaaattctact
attggtgatagtggggtcccagcactgccttctttgacaatgcgtcggatgcgagagtct
gtttcccggatgcctgttagttcccagcacagatactccacaccccacgccttcacattc
aactcctccagcccttcctctgaaggttccctctcccagaggcagaggtcgacgtccaca
cctaatgtccacatggtcagcaccaccctgcctgtggacagcagaatgattgaggatgca
attcgaagccacagtgaatcagcctcaccttcagccttgtccagcagccctaacaatctg
agcccaacgggctggtcacagcccaaaacccctgtgccagcacagagagagcgggcacca
ggatctgggacccaggagaaaaacaaaattaggcctcgtggacagagagattcaagctat
tactgggaaatagaagccagcgaagtgatgctgtccactcggattgggtcaggctccttt
ggcacggtgtataagggcaagtggcacggagatgttgcagtaaaaatcctaaaggttgtc
gaccccacaccagagcagttccaggccttcaggaacgaggtggctgttctccgcaaaaca
cggcacgtgaacatcctgctcttcatggggtacatgacgaaggataacctggcgattgtg
acccagtggtgcgaaggcagcagcctctacaaacacctgcatgtccaggagactaaattc
cagatgttccagttgattgacatcgcccgccagactgctcagggaatggactatttgcat
gcaaagaacatcatccacagagacatgaaatccaacaatatatttctccatgaaggcctg
acggtgaaaattggagattttggtttggcaacagtgaagtcgcgctggagtggttctcag
caggtcgaacaacccactggctctgtcttgtggatggcccctgaggtgatccgaatgcag
gataacaacccgttcagcttccagtctgatgtctactcgtacggcattgtgctctatgag
ctcatgacaggggagcttccttactcccacatcaataaccgcgatcagatcatctttatg
gtgggccgagggtatgcctccccagacctcagtaagctgtataagaactgccccaaagca
atgaagagactcgtggccgactgcgtcaagaaggtcaaggaggagaggcctcttttcccc
cagatcctgtcttccatcgagctgctccaacactctctgccgaagatcaaccggagcgct
tcggagccatccctgcaccgggcggcccacactgaggacataaacgcctgcacactgacc
acgtcccctcgactgcctgtcttctag

DBGET integrated database retrieval system