KEGG   Odobenus rosmarus divergens (Pacific walrus): 101372267
Entry
101372267         CDS       T05148                                 

Gene name
BCL2
Definition
(RefSeq) apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01521  EGFR tyrosine kinase inhibitor resistance
oro01522  Endocrine resistance
oro01524  Platinum drug resistance
oro04064  NF-kappa B signaling pathway
oro04066  HIF-1 signaling pathway
oro04071  Sphingolipid signaling pathway
oro04115  p53 signaling pathway
oro04140  Autophagy - animal
oro04141  Protein processing in endoplasmic reticulum
oro04151  PI3K-Akt signaling pathway
oro04210  Apoptosis
oro04215  Apoptosis - multiple species
oro04217  Necroptosis
oro04261  Adrenergic signaling in cardiomyocytes
oro04340  Hedgehog signaling pathway
oro04510  Focal adhesion
oro04621  NOD-like receptor signaling pathway
oro04630  JAK-STAT signaling pathway
oro04722  Neurotrophin signaling pathway
oro04725  Cholinergic synapse
oro04915  Estrogen signaling pathway
oro04928  Parathyroid hormone synthesis, secretion and action
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro05014  Amyotrophic lateral sclerosis
oro05022  Pathways of neurodegeneration - multiple diseases
oro05132  Salmonella infection
oro05145  Toxoplasmosis
oro05152  Tuberculosis
oro05161  Hepatitis B
oro05162  Measles
oro05168  Herpes simplex virus 1 infection
oro05169  Epstein-Barr virus infection
oro05170  Human immunodeficiency virus 1 infection
oro05200  Pathways in cancer
oro05206  MicroRNAs in cancer
oro05210  Colorectal cancer
oro05215  Prostate cancer
oro05222  Small cell lung cancer
oro05226  Gastric cancer
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101372267 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101372267 (BCL2)
   04630 JAK-STAT signaling pathway
    101372267 (BCL2)
   04064 NF-kappa B signaling pathway
    101372267 (BCL2)
   04066 HIF-1 signaling pathway
    101372267 (BCL2)
   04071 Sphingolipid signaling pathway
    101372267 (BCL2)
   04151 PI3K-Akt signaling pathway
    101372267 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101372267 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    101372267 (BCL2)
   04215 Apoptosis - multiple species
    101372267 (BCL2)
   04217 Necroptosis
    101372267 (BCL2)
   04115 p53 signaling pathway
    101372267 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101372267 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101372267 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101372267 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    101372267 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101372267 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    101372267 (BCL2)
   04722 Neurotrophin signaling pathway
    101372267 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101372267 (BCL2)
   05206 MicroRNAs in cancer
    101372267 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101372267 (BCL2)
   05226 Gastric cancer
    101372267 (BCL2)
   05215 Prostate cancer
    101372267 (BCL2)
   05222 Small cell lung cancer
    101372267 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101372267 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    101372267 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101372267 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101372267 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101372267 (BCL2)
   05152 Tuberculosis
    101372267 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101372267 (BCL2)
   05161 Hepatitis B
    101372267 (BCL2)
   05162 Measles
    101372267 (BCL2)
   05168 Herpes simplex virus 1 infection
    101372267 (BCL2)
   05169 Epstein-Barr virus infection
    101372267 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101372267 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101372267 (BCL2)
   01524 Platinum drug resistance
    101372267 (BCL2)
   01522 Endocrine resistance
    101372267 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oro01009]
    101372267 (BCL2)
Protein phosphatases and associated proteins [BR:oro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101372267 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 101372267
NCBI-ProteinID: XP_004398116
UniProt: A0A2U3VS76
LinkDB
Position
Unknown
AA seq 235 aa
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGIYSSQPGRTPAPA
RTSPPPAPAAPAAAAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPF
TARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRH
LHTWIQDNGGWDAFVELYGPSMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
NT seq 708 nt   +upstreamnt  +downstreamnt
atggcgcacgctgggagaacagggtatgacaaccgggagatagtgatgaagtacatccac
tataagctgtcgcagaggggctacgagtgggacgccggagacgcgggcgccgcgcccccg
ggggccgcccccgcgccgggcatctactcctcgcagcccgggcgcactcccgcgcccgcc
aggacctcgccgccgcccgccccggccgcccccgccgccgccgccgccgccgcgggccct
gcgctcagccccgtgccacctgtggtccacctgaccctgcgccaggcgggcgacgacttc
tcccgtcgctaccgccgcgacttcgcggagatgtccagccagctgcacctgacacccttc
accgcaaggggacgctttgccacggtggtggaggagctcttcagggatggggtgaactgg
gggaggatcgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtcaaccgg
gagatgtcgcccctggtggacaacatcgctctgtggatgactgagtacctgaaccggcac
ttgcacacctggatccaggacaacggaggctgggatgcctttgtggagctgtacggcccc
agcatgcagcctctgtttgacttctcctggctgtctctgaaggcccttctcagtctggcc
ctggtgggagcttgcatcaccctgggtgcctacctgggccacaaatga

DBGET integrated database retrieval system