KEGG   Odobenus rosmarus divergens (Pacific walrus): 101372359
Entry
101372359         CDS       T05148                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01521  EGFR tyrosine kinase inhibitor resistance
oro04010  MAPK signaling pathway
oro04014  Ras signaling pathway
oro04015  Rap1 signaling pathway
oro04020  Calcium signaling pathway
oro04072  Phospholipase D signaling pathway
oro04144  Endocytosis
oro04151  PI3K-Akt signaling pathway
oro04510  Focal adhesion
oro04540  Gap junction
oro04630  JAK-STAT signaling pathway
oro04810  Regulation of actin cytoskeleton
oro05163  Human cytomegalovirus infection
oro05200  Pathways in cancer
oro05206  MicroRNAs in cancer
oro05214  Glioma
oro05215  Prostate cancer
oro05218  Melanoma
oro05230  Central carbon metabolism in cancer
oro05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101372359 (PDGFRA)
   04014 Ras signaling pathway
    101372359 (PDGFRA)
   04015 Rap1 signaling pathway
    101372359 (PDGFRA)
   04630 JAK-STAT signaling pathway
    101372359 (PDGFRA)
   04020 Calcium signaling pathway
    101372359 (PDGFRA)
   04072 Phospholipase D signaling pathway
    101372359 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    101372359 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101372359 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101372359 (PDGFRA)
   04540 Gap junction
    101372359 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101372359 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101372359 (PDGFRA)
   05206 MicroRNAs in cancer
    101372359 (PDGFRA)
   05230 Central carbon metabolism in cancer
    101372359 (PDGFRA)
   05231 Choline metabolism in cancer
    101372359 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    101372359 (PDGFRA)
   05218 Melanoma
    101372359 (PDGFRA)
   05215 Prostate cancer
    101372359 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101372359 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101372359 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oro01001]
    101372359 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:oro04090]
    101372359 (PDGFRA)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101372359 (PDGFRA)
Protein kinases [BR:oro01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   101372359 (PDGFRA)
CD molecules [BR:oro04090]
 Proteins
  101372359 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE LAT Kinase-like
Other DBs
NCBI-GeneID: 101372359
NCBI-ProteinID: XP_004396325
UniProt: A0A2U3ZBQ1
LinkDB
Position
Unknown
AA seq 1090 aa
MMGTSLLALLILGCLLTGPSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQY
PMSEEENPNVEIRNEENNSGLFVTVLEVVNASAAHTGLYTCYYNHTQTEETEIEGRHIYI
YVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLRSNDGVVHASYDSRQGFN
GTFSVGPYICEATVRGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFN
NEVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLRVPEATVKDSGDYECAARQATKEV
KEMKKVTISVHEKGFIEIKPNFSPLEAVDLHEVKHFVVDVQAYPPPRISWLKDNLTLIEN
LTEITTDIERIQEIRYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELLTQVPSSILD
LVDDHHGSTGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWAILANNISNIITEVHPR
DRSTVEGRVTFTRVEETIAVRCLAKNLLGAESRELKLVAPTLRSELTVAAAVLVLLVIVI
ISLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRIL
GSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVN
LLGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKEELDIFGLNPADDSTRS
YVILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVK
NLLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGL
ARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGM
MVDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWHSEPEKRPSFYHLSEIVEHLLPGQYK
KSYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGSLDEQRLSADSGYI
IPLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGID
SSDLVEDSFL
NT seq 3273 nt   +upstreamnt  +downstreamnt
atgatggggacttcccttctggccctcctgatcttaggctgtctcctcacagggcccagc
ctaatcctctgccagctttcattaccgtctatcctcccgaacgaaaatgaaaaggtcgtg
cagctgaattcatccttttctctgagatgctttggggagagtgaagtgagctggcagtac
cccatgtctgaagaagagaaccccaatgtggaaatcagaaatgaggaaaacaacagtggc
ctttttgtgaccgtgctggaggtggtcaatgcgtcggcggcgcacacaggcttgtacact
tgctattacaaccacactcagacggaggaaacagagattgaaggcaggcacatctacatc
tacgtgccagacccggatgtagcctttgtacctctaggaatgacagattatttagtcatc
gtggaggatgatgattctgccatcataccttgtcgcacaactgatcccgagaccccggtc
accttgcgcagcaatgacggggtggtgcatgcctcctatgacagcagacagggctttaat
gggaccttcagcgttgggccctatatctgcgaagccaccgtcagagggaagaagttccag
accatcccatttaatgtttatgctttaaaagcaacatcagaacttgatctagaaatggaa
gctcttaaaactgtgtataagtcaggggagacaattgtggtcacctgcgccgtctttaac
aatgaggtggtcgaccttcagtggacttaccctggagaagtgaaaggcaaaggcatcacc
atgctggaggaaatcaaggtcccgtccatcaaattggtgtacactctgagggtccccgag
gccacggtgaaagatagtggagattatgaatgtgctgcccgccaggccaccaaggaggtc
aaagagatgaagaaagtcaccatttctgtccatgagaaagggttcattgaaatcaaaccc
aacttcagccctttggaagctgttgacttacatgaagtcaaacattttgtggtggacgtg
caggcctacccccctcccaggatatcctggctgaaggacaacctgactctgattgaaaat
ctcacggagatcaccacggacatagaaaggattcaggaaataaggtatcggagcaaatta
aagctgatccgcgctaaggaggaagacagtggccattacacgattgtcgttcaaaatgaa
gacgatgtgaagagctatactttcgaactcttaactcaagttccctcctctattctggac
ttggttgatgaccaccatggctctacgggaggacagaccgtgagatgcaccgctgaaggg
acgcctcttcctgatatcgagtggatgatctgcaaggatattaagaagtgtaataatgaa
acttcatgggcgattttggccaacaatatctcaaacattatcacggaggtccacccccga
gacaggagtactgtggagggccgagtgacattcaccagggtggaggagaccatcgccgtt
cgatgtctggccaagaatctccttggggccgagagccgagagctgaagctggtggccccc
acgctgcgttctgaactcaccgtcgccgctgcggtcctcgtgctgttggtgattgtgatc
atctcacttattgtcctggttgtcatttggaaacagaaaccgaggtatgaaattcgctgg
agggtcattgaatccatcagccctgatggacatgaatatatttacgtggacccaatgcag
ctgccttatgactcaagatgggagtttccaagggatggactcgtgcttggtcgtatcctg
ggatctggtgcgtttgggaaagtggttgaaggaactgcctatgggttaagccgctcccag
cctgtcatgaaagtggcagtgaagatgctaaaacccacagccagatccagtgagaaacaa
gctctcatgtcggaactgaagataatgactcacctggggccgcatttaaacattgtgaac
ttgctgggagcctgtaccaagtcaggccctatttacatcatcaccgagtactgcttctat
ggggatttggtcaactatttgcataagaatagggatagcttcctgagccgccacccggag
aagccaaaggaagagctggacattttcggattgaaccctgccgatgacagcacacggagt
tatgttattttatcttttgaaaacaatggtgactacatggacatgaagcaagctgacacc
acacagtacgtccccatgctggaaaggaaagaggtttctaaatactcggacatccagaga
tcgctgtatgaccgcccagcctcgtataagaagaaatctatgttagactcagaagtcaaa
aacctcctttcagatgataactcagaaggccttactttgttggacttgttgagcttcacc
tatcaagttgcacgaggaatggaatttttggcttcgaaaaattgtgtccaccgggacctg
gctgctcgaaatgtcctcctggcgcaggggaaaatcgtgaagatctgtgacttcggcctg
gccagagacatcatgcatgattcaaactacgtgtccaaaggcagtacctttctccctgtg
aagtggatggcccctgagagcatctttgacaacctctacaccacgctgagtgacgtctgg
tcctacggcattctgctctgggagatcttttcccttggcggcacaccctaccctggcatg
atggtggattctactttctacaataagatcaagagtgggtaccggatggccaagcctgac
cacgccacaagcgaagtctacgagatcatggtgaagtgctggcacagcgagccggagaag
agaccctccttctaccacctgagtgagattgtggagcatctgctgcctggacagtataag
aagagttatgaaaagattcacctggacttcctgaagagcgaccaccccgccgtggcgcgc
atgcgcgtggactcggacaacgcctacattggcgtcacctacaaaaacgaggaagacaag
ctgaaggactgggagggcagcctggacgagcagaggctgagcgcggacagcggctacatc
atccccctgcccgacatcgaccctgttcctgaggaggaagacctgggcaagaggaacaga
cacagctcacagacctcagaagagagcgctatcgagacaggttccagcagctctactttc
atcaagagagaggatgaaactatcgaggatatcgacatgatggacgacattggcatagac
tcctcagacctggtagaggacagcttcctgtga

DBGET integrated database retrieval system