KEGG   Odobenus rosmarus divergens (Pacific walrus): 101372422Help
Entry
101372422         CDS       T05148                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04371  Apelin signaling pathway
oro05034  Alcoholism
oro05165  Human papillomavirus infection
oro05169  Epstein-Barr virus infection
oro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101372422 (HDAC4)
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    101372422 (HDAC4)
  09164 Substance dependence
   05034 Alcoholism
    101372422 (HDAC4)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    101372422 (HDAC4)
   05165 Human papillomavirus infection
    101372422 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oro03036]
    101372422 (HDAC4)
Enzymes [BR:oro01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101372422 (HDAC4)
Chromosome and associated proteins [BR:oro03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     101372422 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 101372422
NCBI-ProteinID: XP_004410503
UniProt: A0A2U3WN67
LinkDB All DBs
Position
Unknown
AA seq 1056 aa AA seqDB search
MPSTVDVASALPLQVAPPAVPMDLRLDHQFALPVAEPTLREQQLQQELLALKQKQQLQRQ
ILIAEFQRQHEQLSRQHEAQLHEHIKHQQELLAMKHQQELLEHQRKLERHRREQDLEKQH
REQKLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRNLNHCISSDPRYWYGKTQ
HSSLDQSSPPQSGVSASYNHPVLGMYDSKDDFPLRKTASEPNLKLRSRLKQKVAERRSSP
LLRRKDGPVVTALKKRPLDVTDSACSSAPGSAPSSPNNSSGNVSTENGITPAVASIPAET
GLAHRLVTREGSVAPLPLYTSPSLPNITLGLPATGPSAGTAGQQEAERLALPALQQRISL
FPGTHLTPYLSTAPLERDSGAAHNPLLQHMVLLEQPPAQTPLVTGLGALPLHAQPLVGAD
RVSPSMHKLRQHRPLGRTQSAPLPQNAPALQHLVIQQQHQQFLEKHKQHFQQQLHMNKII
PKQSEPARQPESHPEETEEELREHQALLEEPYLDRRSGQKEAHALAGVQVKQEPIESDDE
EAEPPRGVEPGQRQPTEQELLFTQQALLLEQQRIHQLRNYQASMEAAGIPVSFGGHRPLS
RAQSSPASATFPMSVQEPPTKPRFTTGLVYDTLMLKHQCTCGNTNSHPEHAGRIQSIWSR
LQETGLRGKCECIRGRKATLEELQTVHSEAHALLYGTNPLNRQKLDSKKLLGSLTSVFVR
LPCGGVGVDSDTIWNEVHSSGAARLAVGCVIELVFKVATGELKNGFAVVRPPGHHAEEST
PMGFCYFNSVAIAAKLLQQRLDVSKTLIVDWDVHHGNGTQQAFYNDPNVLYISLHRYDDG
NFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDPPMGDAEYLAAFRTVVMPIANEFAPDVVL
VSSGFDAVEGHPTPLGGYNLSAKCFGYLTKQLMGLAGGRIVLALEGGHDLTAICDASEAC
VSALLGNELDPLPEKVLQQRPNANAVRSMEKVIEIHSQYWRSLPRLCSTVGHSLVEAQKC
ENEEAETVTAMASLSVGVKPAEKRPDEEPMEEEPPL
NT seq 3171 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcacagtggatgtggcctccgcactgcctctgcaggtcgctcccccggcggtg
cccatggacctccgcctggaccaccagtttgcactgcccgtggcggagcccaccctccgg
gagcagcagctgcagcaagagctgctggccctcaagcagaagcagcagctccagaggcag
atcctcatcgccgagttccagaggcagcacgagcagctctcccggcaacacgaggcccag
ctgcacgagcacataaaacatcagcaggagctgctggccatgaagcatcagcaggagctg
ctggagcaccagcggaagctggaacggcaccgccgggagcaggacctggagaagcagcac
cgggagcagaagctgcagcagctcaagaacaaggagaaaggcaaagagagtgcggtggcc
agcacagaagtgaagatgaagttgcaagagtttgtcctcaataaaaagaaggccctggcc
caccggaacctcaaccactgcatttccagtgaccctcgctactggtacgggaaaacacag
cacagttcgcttgaccagagctccccgccccagagcggggtgtcggcctcctacaaccac
ccggtcctgggaatgtacgacagcaaagatgacttcccgctcagaaaaacagcttctgaa
cccaatttgaaattacggtccaggctgaagcagaaggtggccgaacggcggagcagcccc
ctgctgcgcagaaaagatgggccagtggttacagctctgaagaagcgtccgctggatgtc
acagactcggcgtgcagcagtgcccccggctccgcgcccagctcccccaacaacagctcc
gggaacgtcagcacggagaacgggatcacgcctgctgtcgccagcatcccggccgagacc
ggcttggcgcacagactcgtgactcgagaaggctccgtggccccactccccctctacacg
tcaccatccttgcccaacatcacgctggggctgcctgccaccgggccgtctgctgggacg
gccggccagcaggaagctgagagactggctctcccggccctccagcagcggatctccctc
ttccccggcacccacctcactccctacctgagcacggcgcccctggagcgcgacagcggg
gctgcgcacaaccccctcctgcagcacatggtcctcctggagcaaccacccgcacagaca
cccctggtcacaggcctgggcgcgctgcccctgcacgcgcagcctctggtgggcgcggac
cgcgtgtccccgtccatgcacaagctgaggcagcaccgcccgctggggcgcacccagtcg
gccccactgccccagaacgcgccggccctacagcacctggtgatccagcagcagcaccag
cagttcctggagaagcacaagcagcacttccagcagcagctgcacatgaacaagattatc
cccaaacagagcgagccggcccggcagcccgagagccaccctgaggagaccgaggaggaa
cttcgcgagcaccaggccctcctggaggagccctacctggaccggcggtcagggcagaag
gaggcgcacgcgctggccggggtgcaagtgaagcaggagcccattgagagtgacgacgag
gaggcggagcccccgcggggcgtggagcccggccagcgccagcccacagagcaggagctg
ctcttcacacagcaagcccttctcctggagcagcagcggatccaccagctgaggaactac
caggcatccatggaggccgccggcatccctgtgtccttcggcggccaccggcctctgtcc
cgggcgcagtcctccccggcgtctgccaccttccccatgtctgtgcaggagccccccacc
aaaccgaggttcaccacaggccttgtgtatgacacgctgatgctgaagcaccagtgcacc
tgtgggaacaccaacagccaccccgagcacgccggcaggatccagagcatctggtctcgg
ctgcaggagaccggcctccgaggcaaatgtgagtgcatccgcggacggaaggccacgctg
gaggaactgcagaccgtgcattcggaggcgcacgccctgctctatggcacaaaccccctc
aacaggcagaaactggacagtaagaaacttctaggctcgctaacatcggtgtttgtcagg
ctgccctgtggtggtgtcggggtggacagcgacaccatatggaacgaggtgcactcatca
ggtgcggcccgcctcgccgtgggctgcgtgatcgagctggtcttcaaggtggccacgggg
gagctgaagaacggctttgccgtggtccgtcctccaggacatcacgcagaggagagcaca
cccatgggcttctgctactttaactctgtggccatcgcggccaagcttctccagcagcgg
ctggatgtgagcaagaccctcatagtggactgggacgtacatcacggaaatgggacccag
caggccttctacaacgacccgaacgtcctgtacatctctcttcaccgttatgacgacggg
aacttcttcccaggcagcggggctccggacgaggtgggcacggggccgggcgtgggcttc
aacgtcaacatggctttcaccggcggccttgacccccccatgggcgacgcagagtacttg
gcggccttcagaaccgtggtcatgcccatcgcgaacgagtttgccccagatgtggtgctc
gtgtcgtcaggcttcgacgctgtggagggccaccccacacccctcggcggctacaacctc
tccgctaaatgtttcgggtacctgacgaagcagctgatgggcttggctggcggccggatc
gttctggccctggaggggggccacgacctcacggccatctgcgacgcctcggaagcatgt
gtttctgctttgctgggcaacgagcttgatcctctcccagagaaggtcttacagcagaga
cccaacgctaatgcggtccggtccatggagaaagtcattgaaatccacagccagtactgg
cgctccctgccgcgcctctgctccacggtgggacactcactggtagaggcccagaagtgt
gagaatgaggaagccgagaccgtcaccgccatggcctcgctgtccgtgggcgtgaagccc
gccgagaagagacccgacgaggagcccatggaggaggagccgccgctgtag

DBGET integrated database retrieval system