KEGG   Odobenus rosmarus divergens (Pacific walrus): 101373063
Entry
101373063         CDS       T05148                                 

Gene name
IL5RA
Definition
(RefSeq) interleukin-5 receptor subunit alpha
  KO
K05067  interleukin 5 receptor alpha
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04060  Cytokine-cytokine receptor interaction
oro04630  JAK-STAT signaling pathway
oro04640  Hematopoietic cell lineage
oro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101373063 (IL5RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101373063 (IL5RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101373063 (IL5RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101373063 (IL5RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:oro04050]
    101373063 (IL5RA)
   04090 CD molecules [BR:oro04090]
    101373063 (IL5RA)
Cytokine receptors [BR:oro04050]
 Interleukin receptor families
  IL3 receptor family
   101373063 (IL5RA)
CD molecules [BR:oro04090]
 Proteins
  101373063 (IL5RA)
SSDB
Motif
Pfam: IL6Ra-bind fn3 Interfer-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 101373063
NCBI-ProteinID: XP_012417479
UniProt: A0A2U3ZER5
LinkDB
Position
Unknown
AA seq 417 aa
MAPALLVLLWAMVIPRADLLPDKNSLLLPPANFTIKVIGLAQVLLHWEPNPDQEPKDVEL
GYHVRINAPQEDDYETRNTESKRVTVLHQGFSASVQTIPWNGHSLLASNWVSAELKAPPG
SPGTSIVNLTCTTNTTLNNYNLLRPYQVSLYCTWLVGKDAPEDTQYFLYYRYGSSTEECQ
EYRKDTLKRNIACWFPRTFISSRGSDSLAVHANGSSKHATIKPFDQLFALHAIDRINPPV
NVTAETEGTCLSIQWEKPISAFPNHCFEYEVKIYNTRKNYFQTEKMTTNTFISIIDDISK
YCIQVRAAVSSVCRQMGFWSEWSQPVYVGNDDQKLSTEWFLIVLMATICFIVLIFTLICK
IGHLWTRLFPPVPAPKNSIKDFFLIVRPEKTVSNETEIEVISYVEEPGLETLEDSVF
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggcacctgcactactggttctgttgtgggctatggtgataccaagagcagacttactt
cccgataaaaactctttacttctcccacctgccaacttcaccatcaaagttattggtcta
gcccaagttcttttacactgggaaccaaatcctgatcaagagccaaaggatgtcgagcta
gggtatcacgtgagaataaatgctcctcaagaagatgattatgaaaccagaaacactgaa
agcaaacgcgtaaccgttcttcatcaaggcttttcagcaagtgtgcagaccatcccatgg
aatggccactccctcctggcaagcaactgggtttctgctgagcttaaagccccaccgggg
tctcctggaacctcgattgtgaatttaacgtgtacgacgaacaccacattaaataactat
aatctcttaaggccataccaagtttctctttactgtacctggctcgttggcaaggatgcc
cctgaggatacgcagtatttcctctactacaggtatggctcctcgaccgaagagtgccag
gagtataggaaagacacgctgaagagaaatattgcatgttggtttccgaggacttttatc
agtagcagagggagcgactccctggcagtgcatgctaacggctcaagcaagcatgctaca
atcaagccttttgatcagctgtttgctctgcatgcaattgatcgaattaatcctccagtg
aatgtcacagcagagactgaaggaacctgtctttctattcagtgggagaaacccatttct
gcttttccaaatcattgctttgaatatgaagtgaagatttacaacacaaggaaaaattat
tttcagacagaaaaaatgacgacgaatacattcatctcgataattgatgatatttctaag
tattgcattcaagtgagagcagcagtgagttctgtgtgcagacagatggggttttggagt
gagtggagccaacctgtatatgtgggaaatgatgatcagaagctctccacagaatggttt
ctcatcgtgcttatggcaaccatctgcttcatcgtgttaattttcaccctcatctgtaaa
ataggtcacttatggaccaggctgtttccaccggttccagcaccaaaaaatagtattaaa
gatttctttctaatcgtcagacctgagaaaaccgtttccaacgaaacagaaattgaagtc
ataagttatgtggaagagcctggacttgagaccctagaagattccgtgttttga

DBGET integrated database retrieval system