KEGG   Odobenus rosmarus divergens (Pacific walrus): 101373105
Entry
101373105         CDS       T05148                                 

Gene name
IL11RA
Definition
(RefSeq) interleukin-11 receptor subunit alpha isoform X1
  KO
K05056  interleukin 11 receptor alpha
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04060  Cytokine-cytokine receptor interaction
oro04630  JAK-STAT signaling pathway
oro04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101373105 (IL11RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101373105 (IL11RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101373105 (IL11RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:oro04050]
    101373105 (IL11RA)
Cytokine receptors [BR:oro04050]
 Interleukin receptor families
  IL6/12 receptor family
   101373105 (IL11RA)
SSDB
Motif
Pfam: ig Ig_3 Ig_2 EpoR_lig-bind
Other DBs
NCBI-GeneID: 101373105
NCBI-ProteinID: XP_004392278
UniProt: A0A2U3VCI3
LinkDB
Position
Unknown
AA seq 422 aa
MSSSCSGLSRVLLAVAIALVSAASPCPQAWGPPGFQYGQPGRSMTLCCPGVTAGAPVSWF
RDGETRLLQGPDSGLGHELVLARADSTDEGTYICRTLDGVLGGIVTLQLGYPPARPVVSC
QAADYENFSCTWSPSQVSGLPTRYLTSYRKKTVPGADGLRRSPSTGPWPCPQDPPGAARC
VVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLHASW
TYPASWPRQPHFLLKFRLQYRPVQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLD
AGTWSAWSPEAWGTPSTGPLPEEIPAGGQTQKQLEEEPQADSPAPPRPSLLPDPRPLDHR
DPLEQVAVLASLGIFSFLGLAAGALALGLWLRLRPAGKDGPQKPGFLAPVIPVDKLPGAP
NL
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgagcagcagctgctcagggttgagcagggtcctgctggctgtggctatagccctagtg
tccgctgcctccccctgtccccaggcctggggccccccagggttccagtatgggcagccc
ggcaggtccatgacactgtgttgccctggagtgactgctggggccccggtgtcctggttt
cgggacggggagacaaggctgctccagggacctgactctgggctagggcatgaactggtc
ttggcccgggcagacagcactgacgaaggcacctacatctgccggaccctggatggcgta
cttgggggcattgtgacactacagctgggctaccccccagcccgccctgttgtctcctgc
caagcagctgactatgagaacttctcctgcacttggagtcccagtcaggtcagcggttta
cccacccgctacctcacctcctacaggaagaagaccgtaccaggagctgatggcctgagg
aggagtccctccacaggaccctggccatgcccccaggatcccccgggagctgcccgctgt
gtagtccatggggccgagttctggagccagtaccgaataaatgtgactgaggtgaacccc
ctgggggccagcacacgcctgctggacgtgagcttgcagagcatcttgcgccctgaccct
ccccaagggcttcgcgtcgagtcggtccctggctatccccgccgcctgcatgccagctgg
acgtaccctgcctcctggccccgccagccccactttctgctcaagttccgactgcagtac
cgtccagtgcagcatccagcctggtccacggtggagccggctggattggaggaggtgatc
acggatgctgtggctgggctgccccacgctgtacgggtcagtgccagggactttctggat
gctggcacctggagtgcctggagtcctgaggcctgggggactccaagcaccgggccccta
ccggaagagataccagctgggggacagacacagaagcagctggaggaggagcctcaggca
gacagccccgctccccccaggccctccctcctgccagacccacggccacttgaccacaga
gaccccctggagcaggtagcagtgctggcatctctggggatcttctctttcctgggactg
gcagctggggccctggcactggggctctggctgagactgagaccagctgggaaggatgga
ccccaaaagcctgggttcttggctccagtgattccagtggacaagcttccaggagcccca
aacctgtag

DBGET integrated database retrieval system