KEGG   Odobenus rosmarus divergens (Pacific walrus): 101373228
Entry
101373228         CDS       T05148                                 

Gene name
IL4R
Definition
(RefSeq) interleukin-4 receptor subunit alpha
  KO
K05071  interleukin 4 receptor
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04060  Cytokine-cytokine receptor interaction
oro04151  PI3K-Akt signaling pathway
oro04630  JAK-STAT signaling pathway
oro04640  Hematopoietic cell lineage
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro05200  Pathways in cancer
oro05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101373228 (IL4R)
   04151 PI3K-Akt signaling pathway
    101373228 (IL4R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101373228 (IL4R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101373228 (IL4R)
   04658 Th1 and Th2 cell differentiation
    101373228 (IL4R)
   04659 Th17 cell differentiation
    101373228 (IL4R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101373228 (IL4R)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101373228 (IL4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:oro04050]
    101373228 (IL4R)
   04090 CD molecules [BR:oro04090]
    101373228 (IL4R)
Cytokine receptors [BR:oro04050]
 Interleukin receptor families
  IL2 receptor family
   101373228 (IL4R)
CD molecules [BR:oro04090]
 Proteins
  101373228 (IL4R)
SSDB
Motif
Pfam: IL4Ra_N EpoR_lig-bind fn3
Other DBs
NCBI-GeneID: 101373228
NCBI-ProteinID: XP_004397193
UniProt: A0A2U3VPT6
LinkDB
Position
Unknown
AA seq 796 aa
MGQLCSGLTFPVSCLILVWVTGSGSVKVLQEPSCLSDYVSTSVCQWEMDSPTNCSAELRL
SYQLDFMGSENRTCVPENREGAVCTCSMPIDDVVEADVYQLDLWAGKQQLWGGTFQPSAH
VKPRTPGNLTVHPNVSHTWLLMWTNPYPSENHLYSELTYMVNISNENDPTDFKVYNVTYV
GPALRVAASTLKSGASYSARVRAWAQSYNSTWSEWSPSTTWLNYYEPWEQYLPLSVTISC
LVILAICLSCYISIIKIKKGWWDQIPNPAHSPLVAIVIQDSQVSLWGKRSRGQEPAKCPH
WKTCLTKLLPCLLEHSMDTDEDSSKTARNAPFQAPGKSAWCPVEVSKTILWPESISVVQR
VELFEAPVENEEEEEMEEDKRSFCPSPEGSGGSLQEGREDIAARLTESLFLDLLGGEPGG
FCPQGSEESCLPPLGSECPQMPWAEFPGAGPQPLHPKSTPWASPTPRPASPAFTEMPPVV
TDNPAYRSFGSLLGQSAAPGEGDCHPELAERPGEADPGIPSAPRPEPESWEQILRQSVLQ
HREAPAPGPGPSSGYREFVCAMQQACAPDTGVAGSGPSGEAGYKAFSSLLPGTSGDEASH
GEGGYKPFQSLAPGGPGAPAPVPLFTFGLDVEPARSPRALLLAGSAPGHLGVEPAGKEGD
SHKTLLAPEQATDTLRDDLAGSIVYSALTCHLCGHLKQWHSQEERGKAHVVPSPCCGCCR
DQSSPLVSPLRAPDTLPGGAPLEASLSPASLAPLGISEEGKPSLSFQPAPSNAQSSSQTP
TEVAMLSIEPMCISAS
NT seq 2391 nt   +upstreamnt  +downstreamnt
atggggcagctttgctctgggctcacattccctgtgagctgcctgatcctggtgtgggtg
acaggctctgggagtgttaaggtcctgcaggagcccagctgcttgtccgactacgtcagc
acctctgtctgtcagtgggagatggacagtcccaccaactgcagtgccgagctccgcctg
tcctaccagctggacttcatggggtccgaaaaccgcacgtgtgtccccgagaaccgagaa
ggcgcggtgtgcacatgcagcatgccgatagatgacgtggttgaagcggacgtctatcag
ctggacctgtgggctgggaagcagcagctgtggggcggcaccttccagcccagcgcgcat
gtgaaacccaggacccccgggaacctcacggttcaccccaacgtctcccacacgtggctg
ctgatgtggacaaacccgtaccctagcgagaatcacttgtactccgagctcacctacatg
gtcaacatttccaatgaaaacgaccccacggacttcaaagtctataacgtgacttacgtg
gggcctgccctccgcgtggcggccagcaccctcaagtctggagcatcctacagcgcacga
gtgagggcctgggctcagagctacaacagcacgtggagtgagtggagccccagcacaacg
tggcttaactactatgagccctgggagcagtacctgccgcttagcgtcaccatctcctgc
cttgtcatcctggccatctgcctgtcctgctacatcagcatcatcaagattaagaaagga
tggtgggaccagattccgaacccagcccacagccccctagtggccatagtcatccaggac
tcacaggtgtcactgtgggggaagcggtcccgaggccaggaaccagctaagtgcccacac
tggaagacctgtcttaccaagctcctgccctgtttactggagcacagcatggacacggac
gaggactcctctaagactgccagaaatgcgcctttccaggctcctggaaaatcagcgtgg
tgccctgtggaggtcagcaagacgatcctctggccagagagcatcagcgtggtgcagcgt
gtggagctctttgaggccccggtggagaatgaggaggaggaggagatggaggaagataaa
agaagcttctgcccatcgcccgagggcagcgggggcagcctccaggagggcagggaggac
atcgcagcccggctgacagaaagcctcttcctggaccttctcgggggggagcctgggggc
ttttgcccacagggttcggaggagtcctgccttcctcctctaggaagtgagtgccctcag
atgccctgggctgagttcccgggtgcggggccccagcctctgcaccccaagtccactcct
tgggcctctccaaccccgaggccggccagcccggctttcacggagatgccccctgtcgtc
acagacaaccccgcgtaccgcagcttcggcagcctcctgggccagtccgcagcccccggg
gagggtgactgccacccagagctggccgaacgccctggggaagcagaccccggcatcccc
tccgccccccggcctgagccagaaagctgggagcagattttgcgccagagtgtcctccag
caccgggaggccccggcccccggcccgggccccagcagcggctaccgggagttcgtgtgc
gccatgcagcaggcctgcgcccccgacaccggggtggcgggctctggcccttccggggaa
gcagggtacaaggccttctccagcctgctcccggggacatctggggatgaggccagccat
ggggaggggggctacaaacccttccagagcctcgctcctggtggccctggggcccccgcc
cccgtccccctgttcaccttcggactggacgtagagccggcgcgcagccctcgggccttg
ctcctcgcaggcagcgccccagggcacctgggtgtggagccggcggggaaggaaggggac
agccacaagaccctgctggccccggagcaggccacagacaccctcagggacgacctggcc
ggcagcatcgtctactcggccctcacctgccacctgtgtggccacctgaagcagtggcac
agccaggaggagcgtggcaaggcccacgtggtgcccagcccctgctgtggctgctgcaga
gaccagtcctcgcccctggtgagccccctgcgggccccagacaccctgccagggggggct
cctctggaggccagcctttctccagcctccctggcccccttgggcatctcagaggagggc
aagccctccctgtccttccagcctgcccccagcaatgcacagagctcaagccagaccccc
acagaggtggccatgctctccattgagcccatgtgcatcagcgcttcttag

DBGET integrated database retrieval system