KEGG   Odobenus rosmarus divergens (Pacific walrus): 101373969Help
Entry
101373969         CDS       T05148                                 

Gene name
HK1
Definition
(RefSeq) hexokinase-1 isoform X2
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00010  Glycolysis / Gluconeogenesis
oro00051  Fructose and mannose metabolism
oro00052  Galactose metabolism
oro00500  Starch and sucrose metabolism
oro00520  Amino sugar and nucleotide sugar metabolism
oro00524  Neomycin, kanamycin and gentamicin biosynthesis
oro01100  Metabolic pathways
oro01200  Carbon metabolism
oro04066  HIF-1 signaling pathway
oro04910  Insulin signaling pathway
oro04930  Type II diabetes mellitus
oro04973  Carbohydrate digestion and absorption
oro05230  Central carbon metabolism in cancer
Module
oro_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
oro_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101373969 (HK1)
   00051 Fructose and mannose metabolism
    101373969 (HK1)
   00052 Galactose metabolism
    101373969 (HK1)
   00500 Starch and sucrose metabolism
    101373969 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    101373969 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    101373969 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101373969 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101373969 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101373969 (HK1)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    101373969 (HK1)
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    101373969 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oro04131]
    101373969 (HK1)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     101373969 (HK1)
Membrane trafficking [BR:oro04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    101373969 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 101373969
NCBI-ProteinID: XP_004393736
UniProt: A0A2U3VG58
LinkDB All DBs
Position
Unknown
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDIMTRFKKEMKNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEQNQNVHMESEIYDTPENIVH
GSGSQLFDHVAECLGDFMEKKKIKDKKLPVGFTFSFPCRQSKIDEGILITWTKKFKASGV
EGMDVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YLGELVRLILVKMAKESLLFEGRITPELLTRGKFKTSDVSAIEKNKEGLHNAKEILTRLG
VEPSDDDCISVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTH
PQFSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFRLT
KDMLLEVKKRMRAEMDMGLRKQTHEKAVVKMLPSFVRSTPDGTEHGDFLALDLGGTNFRV
LLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPKMPLGF
TFSFPCKQTSLDAGILITWTKGFKATDCVGHDVATLLREAIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMLEGNDGRMCINMEWGAFGDNGCLDD
IRTIYDRLVDEYSLNAGKQRFEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRG
IFQTKYLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCGAGMAA
VVDKIRENRGLDHLNVTVGVDGTLYKLHPHFSRIMYQTVKELSPKCNVSFLLSEDGSGKG
AALITAVGVRLREETSS
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcgcagctcctggcctattacttcaccgagctgaaggatgaccaagtcaaa
aagattgacaagtatctctatgccatgcggctctccgatgaaactctgatagatatcatg
actcgtttcaagaaggagatgaagaatggcctctcccgggattttaatccaacagccaca
gtcaagatgttgccaacgtttgtaaggtccatccctgatggttcagaaaagggagatttc
attgccctggatcttggcgggtcttcctttcgaattctgagggtgcaagtgaatcatgag
caaaaccagaacgttcacatggagtccgagatttacgacaccccggagaacatcgtgcac
ggcagtggaagccagctttttgatcacgtggctgagtgcctgggagacttcatggagaaa
aaaaaaatcaaggacaagaaattacctgtgggattcacgttttctttcccttgtcggcag
tccaaaatagacgagggcatcctgatcacctggacaaagaaatttaaagcgagtggagtg
gagggaatggatgtggtgaagctgcttaacaaagccatcaaaaagcgcggggactacgat
gccaacattgtggccgtggtgaacgacacggtggggaccatgatgacctgtggctatgat
gaccagcagtgtgaagtcggcctcatcatcggcactggcaccaatgcctgctacatggag
gaactgaggcacattgacctggtggaaggcgatgaggggaggatgtgcatcaacacagaa
tggggggccttcggggacgacgggtccctggaagacatccgcaccgagttcgaccgagag
atagaccgcggctccctcaaccctgggaagcagctgtttgagaagatggtcagtggcatg
tacttgggggagctggtgcgactgatcctggtcaagatggccaaggagagcctcttattt
gaagggcggattaccccggagctgctcaccagggggaagttcaagaccagcgatgtgtca
gccattgagaagaataaggaaggcctccacaatgccaaagaaatcctgacccgcctggga
gtggagccatccgatgacgactgtatttcagtccagcacgtgtgtaccattgtctcattt
cgctctgccaacctggtggctgcaacgctgggcgccatcttgaaccgccttcgagataac
aagggcacacccaggctgcggaccacggttggtgtcgacgggtctctttacaagacgcac
ccacagttttcccggcgtttccacaagactctgaggcgcttggtgcccgactccgatgtg
cgtttcctcctctcggagagcggcagcggcaaaggggccgccatggtcaccgcggtggcc
taccgcctggcggagcagcaccgacagattgaggagaccctggcccacttccgcctcacc
aaggacatgctgctggaggtgaagaagagaatgcgggctgagatggatatgggcctgagg
aagcagacgcacgagaaggccgtggtcaagatgctgccctcctttgtccggagcactcca
gatgggaccgagcatggtgacttcttggcccttgatcttggaggaacaaatttccgtgtc
ctgctggtgaaaatccgcagtgggaaaaagagaacggtggaaatgcacaacaagatctat
gccattcccattgaaatcatgcagggcaccggggaagagctgtttgaccacatcgtctcc
tgcatctctgacttcctggactacatggggatcaaaggccccaaaatgcctctgggcttc
acgttctcattcccctgcaagcagacgagcctggatgcgggaatcttgatcacctggaca
aagggttttaaggcaactgactgcgtggggcacgatgtagcaacattactaagggaagca
ataaaaaggagagaggaatttgacctggatgtggtggctgtggtcaatgacacggtgggc
accatgatgacctgtgcttacgaggagcctacctgcgaggttggactcatcgtagggacc
ggcagcaatgcctgctacatggaagaaatgaagaatgtcgagatgctggaggggaatgat
gggcgcatgtgcatcaacatggagtggggtgcctttggggacaacgggtgtctagatgat
atcagaacaatctatgacagacttgtagatgaatattctctaaacgctgggaaacaaagg
tttgagaagatgattagcggtatgtacctgggtgagatcgtccgcaacatcttgattgac
ttcaccaagaaggggttcctcttccgagggcagatctctgagacgctgaagacccggggc
atctttcagaccaaatatctttcccagattgagagtgaccggttagcgctgctccaggtc
cgggccatcctccagcagctgggcctgaacagcacctgtgacgacagtatcctggtcaag
accgtgtgcggggtggtgtccaagagggctgcacagctgtgtggtgcgggcatggctgcc
gtggtggataagatccgcgagaacagagggctggaccatctcaatgtgactgtgggcgtg
gatggaacactctacaagcttcatccgcacttctccagaatcatgtaccaaaccgtgaag
gaactgtcccccaaatgtaacgtgtccttcctcctgtccgaagacggtagcggcaagggg
gctgctctcatcacggcagtgggcgtccggctccgggaagagacgagcagctaa

DBGET integrated database retrieval system