KEGG   Odobenus rosmarus divergens (Pacific walrus): 101374293
Entry
101374293         CDS       T05148                                 

Gene name
IL7
Definition
(RefSeq) interleukin-7 isoform X1
  KO
K05431  interleukin 7
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04060  Cytokine-cytokine receptor interaction
oro04151  PI3K-Akt signaling pathway
oro04630  JAK-STAT signaling pathway
oro04640  Hematopoietic cell lineage
oro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101374293 (IL7)
   04151 PI3K-Akt signaling pathway
    101374293 (IL7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101374293 (IL7)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101374293 (IL7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101374293 (IL7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oro04052]
    101374293 (IL7)
   00536 Glycosaminoglycan binding proteins [BR:oro00536]
    101374293 (IL7)
Cytokines and growth factors [BR:oro04052]
 Cytokines
  Interleukins
   101374293 (IL7)
Glycosaminoglycan binding proteins [BR:oro00536]
 Heparan sulfate / Heparin
  Cytokines
   101374293 (IL7)
SSDB
Motif
Pfam: IL7
Other DBs
NCBI-GeneID: 101374293
NCBI-ProteinID: XP_004416385
UniProt: A0A2U3X2L9
LinkDB
Position
Unknown
AA seq 175 aa
MFHVSFRYIFGIPPLILVLLPVTSSDCDIEGKDGREYQHVLMISINDLDTMIKNRTNCPN
NEPKVLKKHACDDNKEGMFLYRAARKLKQFVKVNNSEDFNLHLSRVSQGTLQLLNCTPKE
GIKLLSLGEVQPTKNLEDNKSVKEQRKQKSLCSLGILLQKIKTCWNKILRGSKEH
NT seq 528 nt   +upstreamnt  +downstreamnt
atgttccatgtttcttttaggtatatctttggaattcctcccctgatccttgttctgttg
ccagtaacatcatctgattgtgatattgaaggtaaagacggcagagagtatcagcacgtt
ctaatgatcagcatcaatgacttggacactatgataaaaaatcgtaccaattgcccgaat
aatgaacctaaagttttaaaaaaacatgcatgtgatgataataaggaaggtatgttttta
tatcgtgctgctcgcaagttgaagcagtttgttaaagtgaataacagtgaggattttaat
ctccacttatcaagagtttcacagggcacattacaattgttgaactgtacccccaaggaa
ggaataaaactactttccctgggtgaagtccaacccactaaaaatttggaagacaataaa
tctgtaaaggaacagagaaaacagaagagcttgtgttccctagggatactactacaaaag
ataaaaacttgttggaataaaattttgaggggctccaaagaacattga

DBGET integrated database retrieval system