KEGG   Odobenus rosmarus divergens (Pacific walrus): 101374504
Entry
101374504         CDS       T05148                                 

Gene name
CSF1R
Definition
(RefSeq) macrophage colony-stimulating factor 1 receptor
  KO
K05090  macrophage colony-stimulating factor 1 receptor [EC:2.7.10.1]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04010  MAPK signaling pathway
oro04014  Ras signaling pathway
oro04015  Rap1 signaling pathway
oro04060  Cytokine-cytokine receptor interaction
oro04061  Viral protein interaction with cytokine and cytokine receptor
oro04151  PI3K-Akt signaling pathway
oro04380  Osteoclast differentiation
oro04640  Hematopoietic cell lineage
oro05200  Pathways in cancer
oro05202  Transcriptional misregulation in cancer
oro05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101374504 (CSF1R)
   04014 Ras signaling pathway
    101374504 (CSF1R)
   04015 Rap1 signaling pathway
    101374504 (CSF1R)
   04151 PI3K-Akt signaling pathway
    101374504 (CSF1R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101374504 (CSF1R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101374504 (CSF1R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101374504 (CSF1R)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101374504 (CSF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101374504 (CSF1R)
   05202 Transcriptional misregulation in cancer
    101374504 (CSF1R)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101374504 (CSF1R)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101374504 (CSF1R)
Protein kinases [BR:oro01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   101374504 (CSF1R)
CD molecules [BR:oro04090]
 Proteins
  101374504 (CSF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 A_deamin
Other DBs
NCBI-GeneID: 101374504
NCBI-ProteinID: XP_004402864
UniProt: A0A2U3W492
LinkDB
Position
Unknown
AA seq 966 aa
MGPGALLVLLGATTWHVQGVPVIEPRGPELVVEPGTTVTLRCVGDGSVEWDGPIFPHWNL
DTDGPSSILTTNNATFLNTGTYRCTEPGSPLGGSATIHLYVKDPVRPWKVLAQEVTVMEG
QDALLPCLLTDPTLEAGVSLRRVRGRPVMRQTNYSFSPWYGFTIHKAQFTETHGYQCSAR
VGGSMVTSTNIWLKVQKVIPGPPTLTLEPAELVRIQGETAKIVCSARNVDVNFEVFLQHG
ETKLTIPQQSDFQGNQYQKVLALELDHVGFQDAGNYSCVATNVRGISSTSMVFRVVESAY
LNLTSEQNLLQEVTVGEKVDLQVKVEAYPGLQGFNWTYLGPFSDHQPKLNFVMLKDTYRY
TSILSLPRLKPSEAGRYSFLARNTEGEHSLTFELTLLYPPEVRVTWTVINGSDALLCEAS
GYPQPNVTWLECRSHTDRCDEAQGLVLEDSHAEVLSREPFHKVIVRSLLTMGTLEHNRTY
ECRALNSMGNSSQAFRPISIGAHTQLPDEPLFTPVLVTCMSITALLLLLLMLLLYKYKQK
PKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFG
LGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVIT
EYCCYGDLLNFLRRKAEAMLGPSLSVGQDPQAGAGYKNIHLEKKYVRRDSGFSSQGVDIY
VEMRPVSTSSSNDSFSEQDLDKEDGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVAAR
NVLLTSGRVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWSYG
ILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTRRPT
FQQICSFLQERAQVDRREPDYTNLPSSSGGGGSGSEPEESSSEHLACCEQGDIAQPLLQP
NNYQFC
NT seq 2901 nt   +upstreamnt  +downstreamnt
atgggcccaggggctctgctggtcctgctgggggccacaacttggcacgttcaaggagtc
ccagtgatagaacccaggggccctgagctcgtcgtggagccaggcacaacggtgaccctg
cgatgtgtgggcgacggcagcgtggaatgggatggccccatctttccccattggaacctg
gacactgatggccccagcagcatcctgaccacaaataatgccaccttcctaaacacgggg
acctatcgctgcactgaacctggaagccccctggggggcagtgccaccatccacctctat
gtcaaagaccctgttcggccctggaaggtgctggcccaggaagtgacagtgatggagggc
caggacgcactgctgccctgcctgctcaccgaccccacgttggaggcaggcgtctcgcta
aggcgggtgcgcggccggcccgtcatgcgccaaaccaactattccttctcgccctggtat
ggcttcaccatccacaaggcacagttcactgagacccacggctaccaatgcagtgctcga
gtgggtggcagcatggtaacatccacgaacatctggctcaaagtgcagaaagtcatccca
gggcccccgaccttgacgctggagcctgcagagctggtacggattcagggagagactgcc
aagatcgtgtgctcagccaggaatgttgacgttaactttgaagtcttcctccaacacgga
gaaaccaagctcacaatccctcaacaatccgacttccaaggtaaccagtaccaaaaagtc
ctggccctcgagctcgatcacgtaggcttccaagacgccggcaactactcttgcgtggcc
accaatgtccgaggcatcagctccacctccatggtcttccgggtggtagagagtgcctac
ttgaacttgacctctgaacagaacctcctccaggaggtgaccgtgggtgagaaggtcgat
ctccaagtcaaggtggaggcctacccgggcctgcaaggttttaactggacctacctggga
cctttctctgaccaccagcccaagctcaattttgtcatgttgaaggacacatacaggtac
acctctatcctctccctgcctcgcctgaagccctcggaggccggtcgctactccttcctg
gccagaaacactgaaggcgagcattctctgacctttgagctcacgctgctctacccccca
gaggtaagggtcacgtggaccgtcatcaatggctctgacgcactgctctgtgaggcctcc
gggtacccccagcccaatgtgacatggctggagtgcaggagccacacggataggtgtgat
gaggcccaagggctcgtcctagaggactcacacgcggaggtgctgagccgggagcccttc
cacaaggtgatcgtccgtagcctgctgaccatggggaccttggagcacaaccggacttac
gagtgccgggctctcaacagcatggggaacagctcccaggccttcaggcccatctctata
ggagcccacacgcagctccccgacgagccgctcttcacgcccgtgttggtcacctgcatg
tccatcacggccttgttgctgctattgctcatgctgcttctctacaagtacaagcagaag
cccaagtaccaggtgcgctggaagatcatcgagagctacgagggcaacagctacaccttc
attgaccccacccagctgccctacaacgagaagtgggagttcccccgaaacaacctgcag
ttcgggaagactctcggagccggtgcctttgggaaggtggtagaggccacagcctttggt
ctgggcaaggaagatgctgttctgaaggtggctgtgaagatgctgaagtccacggctcac
gcggacgagaaggaggccctcatgtcggaactgaagatcatgagtcacctaggccaacac
gaaaacatagtcaaccttctgggagcctgcacccatggaggccctgttctggtcatcacc
gagtactgttgctatggcgacctgctcaactttctgcgaaggaaggccgaggccatgctg
ggacccagcctgagtgtgggccaggacccccaggcaggtgctggctacaagaacatccac
ctggagaagaaatatgtccgcagggacagcggcttctccagccagggtgtagacatctat
gtggagatgaggcctgtctctacttcttcttcaaacgactccttctctgaacaagacctg
gacaaggaggatgggcgaccactggagttgcgggacctgctccacttctcgagccaggtg
gcccagggcatggcattccttgcttccaagaattgcatacaccgggacgtggcagcacga
aacgtcctgctgaccagtgggcgtgtggccaagatcggggactttgggctggccagggac
atcatgaatgactccaactacatcgtcaagggcaatgcccgcctgcccgtgaagtggatg
gctccagagagcatcttcgactgtgtctacacggttcagagtgacgtctggtcctacggc
atcctgctctgggaaatcttctcactcgggctgaacccctaccctggcatcctggtgaac
agcaagttctataaactggtgaaggatggataccaaatggcccagcctgcatttgcccca
aagaacatatacagcatcatgcaggcctgctgggccctggagcccacccgcagacccacc
ttccagcagatttgctccttcctccaggagcgggcccaagtggacaggagagagccggac
tacaccaacttgccaagcagcagcggcggcggaggcagtggcagtgagccagaggagagc
tccagcgagcacctggcctgctgtgagcagggggatatcgcccagcccctgctgcagccc
aacaactaccagttctgctga

DBGET integrated database retrieval system