KEGG   Odobenus rosmarus divergens (Pacific walrus): 101374708Help
Entry
101374708         CDS       T05148                                 

Gene name
SUV420H2
Definition
(RefSeq) histone-lysine N-methyltransferase SUV420H2
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101374708 (SUV420H2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oro03036]
    101374708 (SUV420H2)
Enzymes [BR:oro01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101374708 (SUV420H2)
Chromosome and associated proteins [BR:oro03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101374708 (SUV420H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 101374708
NCBI-ProteinID: XP_004405134
UniProt: A0A2U3W9X4
LinkDB All DBs
Position
Unknown
AA seq 461 aa AA seqDB search
MGPDRVTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPPLRRQHHLRSALEAFLRQRD
LEAAYRALTLGGWMAHYFQSRGPRQEAALKTHIYRYLRAFLPESGFTILPCTRYSMETNG
AKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAF
INHDCKPNCKFVPADGNAACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECYTCERKGEG
AFRLQPRAPLPPRPLDKYELRETKRRLQQGLDGSGRQGPLGPRACAHLSPLRRDPFCAAC
QPRRPLPCSARLDASPLWLQWLPQPQLRVRPRRRRRPQPRRAPAPPILRTARVSLHQWGG
CGPHCCLRAEALVALGPAPRAHWAPQQDWHWARRYGLPYVVRVDLSRVAPAPPAAPAPAG
TPGPAPIPKQALAFAPFSPPKRLRLVVSHGSIDLDVNGDGP
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgggacctgacagagtgacagccagagagctgtgtgagaatgacgaccttgccaccagc
cttgtcctggacccctacctcggcttccgcacccataagatgaacgtcagccccgtgccc
cccctgcggcgacagcaccacctgcgctcagcgctggaggccttcctgaggcagcgggac
ctggaggctgcgtaccgggccctgacgctgggaggctggatggcccactacttccagagc
cggggcccgcggcaggaggctgccctcaagacccacatctatcgctacctccgagccttc
ctgcctgaaagcggctttaccatcctaccctgtacacgctattccatggagacaaatgga
gccaagattgtgtctaccagagcttggaagaagaacgagaagctggaactgctggtgggc
tgcatcgcagagctgcgggaggccgacgaggggctgctgagggccggggagaacgacttc
agcatcatgtactccacccgaaaacgcagtgcgcagctgtggctgggccctgcagccttc
ataaaccatgactgcaaacccaactgcaagtttgtgcccgcagatgggaacgcggcctgc
gtgaaggtgctccgggacattgagccaggggacgaggtgacctgcttctatggggagggc
ttctttggtgagaagaatgagcactgtgaatgctacacatgtgagaggaaaggcgaagga
gccttccgcctgcagccccgggcaccgctaccccctcggcccctggacaagtatgagctc
cgggagacgaagcggaggctgcagcagggcctggatggcagtggccggcagggtccactg
ggcccgagggcctgtgcccacctctccccgctgcgccgggacccgttctgtgctgcctgc
cagcccaggcgccccctgccttgcagtgcccgccttgacgcctcgcccctctggctccag
tggctgcctcagccccagctccgggtgcgcccccgcaggcgccggcgcccccagccccgg
cgggccccagcgccccccattctccgcactgcccgtgtctccttgcaccaatggggaggc
tgtggtccccactgctgcctgcgtgcagaggccctcgtggccctgggcccggccccccgc
gcccactgggcccctcagcaggactggcactgggcccggcgctatgggctgccttacgtg
gtgcgtgtggacctgagccgcgtggcgccggccccacccgctgcccccgcgcctgcgggg
accccaggccctgcccccatccccaagcaggcccttgccttcgcccccttctccccaccc
aagcgcctgaggctggtggtcagccacggctccattgacctggatgtcaacggtgacggg
ccgtga

DBGET integrated database retrieval system