KEGG   Odobenus rosmarus divergens (Pacific walrus): 101374757
Entry
101374757         CDS       T05148                                 

Gene name
AKT2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01521  EGFR tyrosine kinase inhibitor resistance
oro01522  Endocrine resistance
oro01524  Platinum drug resistance
oro04010  MAPK signaling pathway
oro04012  ErbB signaling pathway
oro04014  Ras signaling pathway
oro04015  Rap1 signaling pathway
oro04022  cGMP-PKG signaling pathway
oro04024  cAMP signaling pathway
oro04062  Chemokine signaling pathway
oro04066  HIF-1 signaling pathway
oro04068  FoxO signaling pathway
oro04071  Sphingolipid signaling pathway
oro04072  Phospholipase D signaling pathway
oro04140  Autophagy - animal
oro04150  mTOR signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04152  AMPK signaling pathway
oro04210  Apoptosis
oro04211  Longevity regulating pathway
oro04213  Longevity regulating pathway - multiple species
oro04218  Cellular senescence
oro04261  Adrenergic signaling in cardiomyocytes
oro04370  VEGF signaling pathway
oro04371  Apelin signaling pathway
oro04380  Osteoclast differentiation
oro04510  Focal adhesion
oro04550  Signaling pathways regulating pluripotency of stem cells
oro04611  Platelet activation
oro04613  Neutrophil extracellular trap formation
oro04620  Toll-like receptor signaling pathway
oro04625  C-type lectin receptor signaling pathway
oro04630  JAK-STAT signaling pathway
oro04660  T cell receptor signaling pathway
oro04662  B cell receptor signaling pathway
oro04664  Fc epsilon RI signaling pathway
oro04666  Fc gamma R-mediated phagocytosis
oro04668  TNF signaling pathway
oro04722  Neurotrophin signaling pathway
oro04725  Cholinergic synapse
oro04728  Dopaminergic synapse
oro04910  Insulin signaling pathway
oro04914  Progesterone-mediated oocyte maturation
oro04915  Estrogen signaling pathway
oro04917  Prolactin signaling pathway
oro04919  Thyroid hormone signaling pathway
oro04920  Adipocytokine signaling pathway
oro04922  Glucagon signaling pathway
oro04923  Regulation of lipolysis in adipocytes
oro04926  Relaxin signaling pathway
oro04929  GnRH secretion
oro04931  Insulin resistance
oro04932  Non-alcoholic fatty liver disease
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro04935  Growth hormone synthesis, secretion and action
oro04973  Carbohydrate digestion and absorption
oro05010  Alzheimer disease
oro05017  Spinocerebellar ataxia
oro05132  Salmonella infection
oro05135  Yersinia infection
oro05142  Chagas disease
oro05145  Toxoplasmosis
oro05152  Tuberculosis
oro05160  Hepatitis C
oro05161  Hepatitis B
oro05162  Measles
oro05163  Human cytomegalovirus infection
oro05164  Influenza A
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05168  Herpes simplex virus 1 infection
oro05169  Epstein-Barr virus infection
oro05170  Human immunodeficiency virus 1 infection
oro05200  Pathways in cancer
oro05205  Proteoglycans in cancer
oro05210  Colorectal cancer
oro05211  Renal cell carcinoma
oro05212  Pancreatic cancer
oro05213  Endometrial cancer
oro05214  Glioma
oro05215  Prostate cancer
oro05218  Melanoma
oro05220  Chronic myeloid leukemia
oro05221  Acute myeloid leukemia
oro05222  Small cell lung cancer
oro05223  Non-small cell lung cancer
oro05224  Breast cancer
oro05225  Hepatocellular carcinoma
oro05226  Gastric cancer
oro05230  Central carbon metabolism in cancer
oro05231  Choline metabolism in cancer
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101374757 (AKT2)
   04012 ErbB signaling pathway
    101374757 (AKT2)
   04014 Ras signaling pathway
    101374757 (AKT2)
   04015 Rap1 signaling pathway
    101374757 (AKT2)
   04370 VEGF signaling pathway
    101374757 (AKT2)
   04371 Apelin signaling pathway
    101374757 (AKT2)
   04630 JAK-STAT signaling pathway
    101374757 (AKT2)
   04668 TNF signaling pathway
    101374757 (AKT2)
   04066 HIF-1 signaling pathway
    101374757 (AKT2)
   04068 FoxO signaling pathway
    101374757 (AKT2)
   04072 Phospholipase D signaling pathway
    101374757 (AKT2)
   04071 Sphingolipid signaling pathway
    101374757 (AKT2)
   04024 cAMP signaling pathway
    101374757 (AKT2)
   04022 cGMP-PKG signaling pathway
    101374757 (AKT2)
   04151 PI3K-Akt signaling pathway
    101374757 (AKT2)
   04152 AMPK signaling pathway
    101374757 (AKT2)
   04150 mTOR signaling pathway
    101374757 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101374757 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    101374757 (AKT2)
   04218 Cellular senescence
    101374757 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101374757 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    101374757 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101374757 (AKT2)
   04613 Neutrophil extracellular trap formation
    101374757 (AKT2)
   04620 Toll-like receptor signaling pathway
    101374757 (AKT2)
   04625 C-type lectin receptor signaling pathway
    101374757 (AKT2)
   04660 T cell receptor signaling pathway
    101374757 (AKT2)
   04662 B cell receptor signaling pathway
    101374757 (AKT2)
   04664 Fc epsilon RI signaling pathway
    101374757 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    101374757 (AKT2)
   04062 Chemokine signaling pathway
    101374757 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101374757 (AKT2)
   04922 Glucagon signaling pathway
    101374757 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    101374757 (AKT2)
   04920 Adipocytokine signaling pathway
    101374757 (AKT2)
   04929 GnRH secretion
    101374757 (AKT2)
   04915 Estrogen signaling pathway
    101374757 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    101374757 (AKT2)
   04917 Prolactin signaling pathway
    101374757 (AKT2)
   04926 Relaxin signaling pathway
    101374757 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    101374757 (AKT2)
   04919 Thyroid hormone signaling pathway
    101374757 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101374757 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101374757 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    101374757 (AKT2)
   04728 Dopaminergic synapse
    101374757 (AKT2)
   04722 Neurotrophin signaling pathway
    101374757 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101374757 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    101374757 (AKT2)
   04213 Longevity regulating pathway - multiple species
    101374757 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101374757 (AKT2)
   05205 Proteoglycans in cancer
    101374757 (AKT2)
   05230 Central carbon metabolism in cancer
    101374757 (AKT2)
   05231 Choline metabolism in cancer
    101374757 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101374757 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101374757 (AKT2)
   05212 Pancreatic cancer
    101374757 (AKT2)
   05225 Hepatocellular carcinoma
    101374757 (AKT2)
   05226 Gastric cancer
    101374757 (AKT2)
   05214 Glioma
    101374757 (AKT2)
   05221 Acute myeloid leukemia
    101374757 (AKT2)
   05220 Chronic myeloid leukemia
    101374757 (AKT2)
   05218 Melanoma
    101374757 (AKT2)
   05211 Renal cell carcinoma
    101374757 (AKT2)
   05215 Prostate cancer
    101374757 (AKT2)
   05213 Endometrial cancer
    101374757 (AKT2)
   05224 Breast cancer
    101374757 (AKT2)
   05222 Small cell lung cancer
    101374757 (AKT2)
   05223 Non-small cell lung cancer
    101374757 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101374757 (AKT2)
   05017 Spinocerebellar ataxia
    101374757 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101374757 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101374757 (AKT2)
   04931 Insulin resistance
    101374757 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101374757 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101374757 (AKT2)
   05135 Yersinia infection
    101374757 (AKT2)
   05152 Tuberculosis
    101374757 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101374757 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    101374757 (AKT2)
   05161 Hepatitis B
    101374757 (AKT2)
   05160 Hepatitis C
    101374757 (AKT2)
   05164 Influenza A
    101374757 (AKT2)
   05162 Measles
    101374757 (AKT2)
   05168 Herpes simplex virus 1 infection
    101374757 (AKT2)
   05163 Human cytomegalovirus infection
    101374757 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101374757 (AKT2)
   05169 Epstein-Barr virus infection
    101374757 (AKT2)
   05165 Human papillomavirus infection
    101374757 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101374757 (AKT2)
   05142 Chagas disease
    101374757 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101374757 (AKT2)
   01524 Platinum drug resistance
    101374757 (AKT2)
   01522 Endocrine resistance
    101374757 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oro01001]
    101374757 (AKT2)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101374757 (AKT2)
Protein kinases [BR:oro01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   101374757 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11
Other DBs
NCBI-GeneID: 101374757
NCBI-ProteinID: XP_004396419
UniProt: A0A2U3VMY7
LinkDB
Position
Unknown
AA seq 481 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPDAPDQTLPPLNNFSVAEC
QLMKTERPRANTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRGPGEDPM
DYKCGSPSDPSVAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKASGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAREVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLELDQRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaatgaggtgtctgtcatcaaagaaggctggctccacaagcgtggtgaatacatcaag
acctggaggccccggtactttctgttgaagagtgacggctccttcattggatacaaggag
cggcctgatgcccctgaccagaccctgccccccctgaacaacttctctgtcgcagaatgc
cagctgatgaagaccgagagaccacgggccaacacctttgtcatacgctgccttcagtgg
accacggtcatcgagaggaccttccatgtagactctccagatgagagggaggagtggatg
cgggccattcagatggtcgccaacagcctcaagcagcggggcccaggtgaggaccccatg
gactataagtgtggctcccccagcgacccttctgtggctgaggagatggaagtggcagtt
agcaaggctcgggccaaggtgaccatgaatgacttcgactatctcaaactgctgggcaag
ggcacctttggcaaagtgattctggtgcgggagaaggccagtggccgctactacgccatg
aagatcctgcggaaggaagtaatcatcgccaaggatgaagtcgcccacacggtcaccgag
agccgggtcctccagaacaccaggcacccgttcctcaccgcactgaagtacgccttccag
acccacgaccgcctgtgcttcgtgatggagtacgccaacgggggtgagctgtttttccac
ctgtcccgggagcgtgtcttcacagaggagcgggctcgcttctacggcgcagagatcgtc
tctgccctcgagtatttgcactcgcgggacgtggtgtaccgcgacatcaagctggagaac
ctcatgctggacaaagatggccacatcaagatcactgacttcggcctctgcaaggagggc
attagtgacggggccaccatgaaaaccttctgtgggacgcccgagtacctggcccccgag
gtgctggaggacaacgactacggccgcgcggtggactggtgggggctgggcgtggtcatg
tacgagatgatgtgcggccgcctgcccttctacaaccaggaccacgagcgcctcttcgag
ctcatcctcatggaggagatccgcttcccgcgcacgctcagccccgaggccaagtccctg
cttgctgggctgcttaagaaggatcccaagcagaggctcggcggggggcccagcgatgcc
agggaggtcatggagcacaggttcttcctcagcatcaactggcaggacgtggtacagaag
aagcttctgccacccttcaaacctcaggtcacctctgaggttgacacaaggtactttgat
gatgagtttaccgcccagtccatcacaatcacgcccccggaccgctatgacagcctgggc
tccctcgaactggaccagcggacccacttcccccagttctcctactcggccagcatccgc
gagtga

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101382320
Entry
101382320         CDS       T05148                                 

Gene name
AKT3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01521  EGFR tyrosine kinase inhibitor resistance
oro01522  Endocrine resistance
oro01524  Platinum drug resistance
oro04010  MAPK signaling pathway
oro04012  ErbB signaling pathway
oro04014  Ras signaling pathway
oro04015  Rap1 signaling pathway
oro04022  cGMP-PKG signaling pathway
oro04024  cAMP signaling pathway
oro04062  Chemokine signaling pathway
oro04066  HIF-1 signaling pathway
oro04068  FoxO signaling pathway
oro04071  Sphingolipid signaling pathway
oro04072  Phospholipase D signaling pathway
oro04140  Autophagy - animal
oro04150  mTOR signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04152  AMPK signaling pathway
oro04210  Apoptosis
oro04211  Longevity regulating pathway
oro04213  Longevity regulating pathway - multiple species
oro04218  Cellular senescence
oro04261  Adrenergic signaling in cardiomyocytes
oro04370  VEGF signaling pathway
oro04371  Apelin signaling pathway
oro04380  Osteoclast differentiation
oro04510  Focal adhesion
oro04550  Signaling pathways regulating pluripotency of stem cells
oro04611  Platelet activation
oro04613  Neutrophil extracellular trap formation
oro04620  Toll-like receptor signaling pathway
oro04625  C-type lectin receptor signaling pathway
oro04630  JAK-STAT signaling pathway
oro04660  T cell receptor signaling pathway
oro04662  B cell receptor signaling pathway
oro04664  Fc epsilon RI signaling pathway
oro04666  Fc gamma R-mediated phagocytosis
oro04668  TNF signaling pathway
oro04722  Neurotrophin signaling pathway
oro04725  Cholinergic synapse
oro04728  Dopaminergic synapse
oro04910  Insulin signaling pathway
oro04914  Progesterone-mediated oocyte maturation
oro04915  Estrogen signaling pathway
oro04917  Prolactin signaling pathway
oro04919  Thyroid hormone signaling pathway
oro04920  Adipocytokine signaling pathway
oro04922  Glucagon signaling pathway
oro04923  Regulation of lipolysis in adipocytes
oro04926  Relaxin signaling pathway
oro04929  GnRH secretion
oro04931  Insulin resistance
oro04932  Non-alcoholic fatty liver disease
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro04935  Growth hormone synthesis, secretion and action
oro04973  Carbohydrate digestion and absorption
oro05010  Alzheimer disease
oro05017  Spinocerebellar ataxia
oro05132  Salmonella infection
oro05135  Yersinia infection
oro05142  Chagas disease
oro05145  Toxoplasmosis
oro05152  Tuberculosis
oro05160  Hepatitis C
oro05161  Hepatitis B
oro05162  Measles
oro05163  Human cytomegalovirus infection
oro05164  Influenza A
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05168  Herpes simplex virus 1 infection
oro05169  Epstein-Barr virus infection
oro05170  Human immunodeficiency virus 1 infection
oro05200  Pathways in cancer
oro05205  Proteoglycans in cancer
oro05210  Colorectal cancer
oro05211  Renal cell carcinoma
oro05212  Pancreatic cancer
oro05213  Endometrial cancer
oro05214  Glioma
oro05215  Prostate cancer
oro05218  Melanoma
oro05220  Chronic myeloid leukemia
oro05221  Acute myeloid leukemia
oro05222  Small cell lung cancer
oro05223  Non-small cell lung cancer
oro05224  Breast cancer
oro05225  Hepatocellular carcinoma
oro05226  Gastric cancer
oro05230  Central carbon metabolism in cancer
oro05231  Choline metabolism in cancer
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101382320 (AKT3)
   04012 ErbB signaling pathway
    101382320 (AKT3)
   04014 Ras signaling pathway
    101382320 (AKT3)
   04015 Rap1 signaling pathway
    101382320 (AKT3)
   04370 VEGF signaling pathway
    101382320 (AKT3)
   04371 Apelin signaling pathway
    101382320 (AKT3)
   04630 JAK-STAT signaling pathway
    101382320 (AKT3)
   04668 TNF signaling pathway
    101382320 (AKT3)
   04066 HIF-1 signaling pathway
    101382320 (AKT3)
   04068 FoxO signaling pathway
    101382320 (AKT3)
   04072 Phospholipase D signaling pathway
    101382320 (AKT3)
   04071 Sphingolipid signaling pathway
    101382320 (AKT3)
   04024 cAMP signaling pathway
    101382320 (AKT3)
   04022 cGMP-PKG signaling pathway
    101382320 (AKT3)
   04151 PI3K-Akt signaling pathway
    101382320 (AKT3)
   04152 AMPK signaling pathway
    101382320 (AKT3)
   04150 mTOR signaling pathway
    101382320 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101382320 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    101382320 (AKT3)
   04218 Cellular senescence
    101382320 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101382320 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    101382320 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101382320 (AKT3)
   04613 Neutrophil extracellular trap formation
    101382320 (AKT3)
   04620 Toll-like receptor signaling pathway
    101382320 (AKT3)
   04625 C-type lectin receptor signaling pathway
    101382320 (AKT3)
   04660 T cell receptor signaling pathway
    101382320 (AKT3)
   04662 B cell receptor signaling pathway
    101382320 (AKT3)
   04664 Fc epsilon RI signaling pathway
    101382320 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    101382320 (AKT3)
   04062 Chemokine signaling pathway
    101382320 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101382320 (AKT3)
   04922 Glucagon signaling pathway
    101382320 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    101382320 (AKT3)
   04920 Adipocytokine signaling pathway
    101382320 (AKT3)
   04929 GnRH secretion
    101382320 (AKT3)
   04915 Estrogen signaling pathway
    101382320 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    101382320 (AKT3)
   04917 Prolactin signaling pathway
    101382320 (AKT3)
   04926 Relaxin signaling pathway
    101382320 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    101382320 (AKT3)
   04919 Thyroid hormone signaling pathway
    101382320 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101382320 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101382320 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    101382320 (AKT3)
   04728 Dopaminergic synapse
    101382320 (AKT3)
   04722 Neurotrophin signaling pathway
    101382320 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101382320 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    101382320 (AKT3)
   04213 Longevity regulating pathway - multiple species
    101382320 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101382320 (AKT3)
   05205 Proteoglycans in cancer
    101382320 (AKT3)
   05230 Central carbon metabolism in cancer
    101382320 (AKT3)
   05231 Choline metabolism in cancer
    101382320 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101382320 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101382320 (AKT3)
   05212 Pancreatic cancer
    101382320 (AKT3)
   05225 Hepatocellular carcinoma
    101382320 (AKT3)
   05226 Gastric cancer
    101382320 (AKT3)
   05214 Glioma
    101382320 (AKT3)
   05221 Acute myeloid leukemia
    101382320 (AKT3)
   05220 Chronic myeloid leukemia
    101382320 (AKT3)
   05218 Melanoma
    101382320 (AKT3)
   05211 Renal cell carcinoma
    101382320 (AKT3)
   05215 Prostate cancer
    101382320 (AKT3)
   05213 Endometrial cancer
    101382320 (AKT3)
   05224 Breast cancer
    101382320 (AKT3)
   05222 Small cell lung cancer
    101382320 (AKT3)
   05223 Non-small cell lung cancer
    101382320 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101382320 (AKT3)
   05017 Spinocerebellar ataxia
    101382320 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101382320 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101382320 (AKT3)
   04931 Insulin resistance
    101382320 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101382320 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101382320 (AKT3)
   05135 Yersinia infection
    101382320 (AKT3)
   05152 Tuberculosis
    101382320 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101382320 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    101382320 (AKT3)
   05161 Hepatitis B
    101382320 (AKT3)
   05160 Hepatitis C
    101382320 (AKT3)
   05164 Influenza A
    101382320 (AKT3)
   05162 Measles
    101382320 (AKT3)
   05168 Herpes simplex virus 1 infection
    101382320 (AKT3)
   05163 Human cytomegalovirus infection
    101382320 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101382320 (AKT3)
   05169 Epstein-Barr virus infection
    101382320 (AKT3)
   05165 Human papillomavirus infection
    101382320 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101382320 (AKT3)
   05142 Chagas disease
    101382320 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101382320 (AKT3)
   01524 Platinum drug resistance
    101382320 (AKT3)
   01522 Endocrine resistance
    101382320 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oro01001]
    101382320 (AKT3)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101382320 (AKT3)
Protein kinases [BR:oro01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   101382320 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2 PH_11
Other DBs
NCBI-GeneID: 101382320
NCBI-ProteinID: XP_004400518
UniProt: A0A2U3VY63
LinkDB
Position
Unknown
AA seq 479 aa
MSDVTVVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCVDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccgtggtgaaagaaggctgggttcagaagaggggagaatatataaaa
aactggaggccaagatatttccttttgaagacagatggctcattcataggatataaagag
aaacctcaagatgtggatttaccttatcccctcaacaacttttcagtggcaaaatgccag
ttaatgaaaacagaacgaccaaagccaaacacatttattatcagatgtctccagtggacc
actgttatagagagaacatttcatgtagatactccagaggaaagggaagagtggacagaa
gctattcaggctgtagcagacagacttcagagacaagaagaggagagaatgaattgtagt
ccaacttcacaaattgataatataggggaggaggagatggatgcttccacaacccatcat
aaaagaaagacaatgaatgattttgactatttgaaactactaggtaaaggcacttttggg
aaagttattttggttcgagagaaggcaagtgggaaatactatgctatgaagattctgaag
aaagaagttattattgcaaaggatgaagtggcgcatactctgactgagagcagagtatta
aagaacaccagacacccctttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgtaaatgggggagagctgtttttccatttgtcgagagag
cgggtgttctccgaggaccgcacacgtttctatggtgcagaaattgtctctgctttggac
tatctacattccggaaagattgtgtaccgtgatctcaagttggagaatttaatgctggat
aaagatggccacataaaaattacagattttggactttgcaaagaagggatcacagatgca
gccaccatgaagacattctgtggcacaccagaatatctggcaccagaggtgttagaagac
aacgactatggccgagccgtggattggtggggcctgggggtcgtcatgtatgagatgatg
tgtgggaggctacctttctacaaccaggatcatgagaaactttttgaactaatactaatg
gaagacattaaatttcctcgaacactttcttcagatgcaaaatcattgctttcagggctc
ttgataaaggatccaaataaacgccttggcgggggcccagatgatgcaaaagaaattatg
aggcacagtttcttctctggagtcaactggcaagatgtttatgataaaaagcttgtacct
ccttttaagcctcaagtaacatctgagacagataccagatattttgatgaagaatttaca
gctcagactattacaataaccccacctgaaaaatatgacgaggacggcatggactgcgtg
gacaacgagcggcggccacacttccctcagttctcctactccgccagcggccgcgagtaa

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101383166
Entry
101383166         CDS       T05148                                 

Gene name
AKT1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01521  EGFR tyrosine kinase inhibitor resistance
oro01522  Endocrine resistance
oro01524  Platinum drug resistance
oro04010  MAPK signaling pathway
oro04012  ErbB signaling pathway
oro04014  Ras signaling pathway
oro04015  Rap1 signaling pathway
oro04022  cGMP-PKG signaling pathway
oro04024  cAMP signaling pathway
oro04062  Chemokine signaling pathway
oro04066  HIF-1 signaling pathway
oro04068  FoxO signaling pathway
oro04071  Sphingolipid signaling pathway
oro04072  Phospholipase D signaling pathway
oro04140  Autophagy - animal
oro04150  mTOR signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04152  AMPK signaling pathway
oro04210  Apoptosis
oro04211  Longevity regulating pathway
oro04213  Longevity regulating pathway - multiple species
oro04218  Cellular senescence
oro04261  Adrenergic signaling in cardiomyocytes
oro04370  VEGF signaling pathway
oro04371  Apelin signaling pathway
oro04380  Osteoclast differentiation
oro04510  Focal adhesion
oro04550  Signaling pathways regulating pluripotency of stem cells
oro04611  Platelet activation
oro04613  Neutrophil extracellular trap formation
oro04620  Toll-like receptor signaling pathway
oro04625  C-type lectin receptor signaling pathway
oro04630  JAK-STAT signaling pathway
oro04660  T cell receptor signaling pathway
oro04662  B cell receptor signaling pathway
oro04664  Fc epsilon RI signaling pathway
oro04666  Fc gamma R-mediated phagocytosis
oro04668  TNF signaling pathway
oro04722  Neurotrophin signaling pathway
oro04725  Cholinergic synapse
oro04728  Dopaminergic synapse
oro04910  Insulin signaling pathway
oro04914  Progesterone-mediated oocyte maturation
oro04915  Estrogen signaling pathway
oro04917  Prolactin signaling pathway
oro04919  Thyroid hormone signaling pathway
oro04920  Adipocytokine signaling pathway
oro04922  Glucagon signaling pathway
oro04923  Regulation of lipolysis in adipocytes
oro04926  Relaxin signaling pathway
oro04929  GnRH secretion
oro04931  Insulin resistance
oro04932  Non-alcoholic fatty liver disease
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro04935  Growth hormone synthesis, secretion and action
oro04973  Carbohydrate digestion and absorption
oro05010  Alzheimer disease
oro05017  Spinocerebellar ataxia
oro05132  Salmonella infection
oro05135  Yersinia infection
oro05142  Chagas disease
oro05145  Toxoplasmosis
oro05152  Tuberculosis
oro05160  Hepatitis C
oro05161  Hepatitis B
oro05162  Measles
oro05163  Human cytomegalovirus infection
oro05164  Influenza A
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05168  Herpes simplex virus 1 infection
oro05169  Epstein-Barr virus infection
oro05170  Human immunodeficiency virus 1 infection
oro05200  Pathways in cancer
oro05205  Proteoglycans in cancer
oro05210  Colorectal cancer
oro05211  Renal cell carcinoma
oro05212  Pancreatic cancer
oro05213  Endometrial cancer
oro05214  Glioma
oro05215  Prostate cancer
oro05218  Melanoma
oro05220  Chronic myeloid leukemia
oro05221  Acute myeloid leukemia
oro05222  Small cell lung cancer
oro05223  Non-small cell lung cancer
oro05224  Breast cancer
oro05225  Hepatocellular carcinoma
oro05226  Gastric cancer
oro05230  Central carbon metabolism in cancer
oro05231  Choline metabolism in cancer
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101383166 (AKT1)
   04012 ErbB signaling pathway
    101383166 (AKT1)
   04014 Ras signaling pathway
    101383166 (AKT1)
   04015 Rap1 signaling pathway
    101383166 (AKT1)
   04370 VEGF signaling pathway
    101383166 (AKT1)
   04371 Apelin signaling pathway
    101383166 (AKT1)
   04630 JAK-STAT signaling pathway
    101383166 (AKT1)
   04668 TNF signaling pathway
    101383166 (AKT1)
   04066 HIF-1 signaling pathway
    101383166 (AKT1)
   04068 FoxO signaling pathway
    101383166 (AKT1)
   04072 Phospholipase D signaling pathway
    101383166 (AKT1)
   04071 Sphingolipid signaling pathway
    101383166 (AKT1)
   04024 cAMP signaling pathway
    101383166 (AKT1)
   04022 cGMP-PKG signaling pathway
    101383166 (AKT1)
   04151 PI3K-Akt signaling pathway
    101383166 (AKT1)
   04152 AMPK signaling pathway
    101383166 (AKT1)
   04150 mTOR signaling pathway
    101383166 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101383166 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    101383166 (AKT1)
   04218 Cellular senescence
    101383166 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101383166 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    101383166 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101383166 (AKT1)
   04613 Neutrophil extracellular trap formation
    101383166 (AKT1)
   04620 Toll-like receptor signaling pathway
    101383166 (AKT1)
   04625 C-type lectin receptor signaling pathway
    101383166 (AKT1)
   04660 T cell receptor signaling pathway
    101383166 (AKT1)
   04662 B cell receptor signaling pathway
    101383166 (AKT1)
   04664 Fc epsilon RI signaling pathway
    101383166 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    101383166 (AKT1)
   04062 Chemokine signaling pathway
    101383166 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101383166 (AKT1)
   04922 Glucagon signaling pathway
    101383166 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    101383166 (AKT1)
   04920 Adipocytokine signaling pathway
    101383166 (AKT1)
   04929 GnRH secretion
    101383166 (AKT1)
   04915 Estrogen signaling pathway
    101383166 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    101383166 (AKT1)
   04917 Prolactin signaling pathway
    101383166 (AKT1)
   04926 Relaxin signaling pathway
    101383166 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    101383166 (AKT1)
   04919 Thyroid hormone signaling pathway
    101383166 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101383166 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101383166 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    101383166 (AKT1)
   04728 Dopaminergic synapse
    101383166 (AKT1)
   04722 Neurotrophin signaling pathway
    101383166 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101383166 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    101383166 (AKT1)
   04213 Longevity regulating pathway - multiple species
    101383166 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101383166 (AKT1)
   05205 Proteoglycans in cancer
    101383166 (AKT1)
   05230 Central carbon metabolism in cancer
    101383166 (AKT1)
   05231 Choline metabolism in cancer
    101383166 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101383166 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101383166 (AKT1)
   05212 Pancreatic cancer
    101383166 (AKT1)
   05225 Hepatocellular carcinoma
    101383166 (AKT1)
   05226 Gastric cancer
    101383166 (AKT1)
   05214 Glioma
    101383166 (AKT1)
   05221 Acute myeloid leukemia
    101383166 (AKT1)
   05220 Chronic myeloid leukemia
    101383166 (AKT1)
   05218 Melanoma
    101383166 (AKT1)
   05211 Renal cell carcinoma
    101383166 (AKT1)
   05215 Prostate cancer
    101383166 (AKT1)
   05213 Endometrial cancer
    101383166 (AKT1)
   05224 Breast cancer
    101383166 (AKT1)
   05222 Small cell lung cancer
    101383166 (AKT1)
   05223 Non-small cell lung cancer
    101383166 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101383166 (AKT1)
   05017 Spinocerebellar ataxia
    101383166 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101383166 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101383166 (AKT1)
   04931 Insulin resistance
    101383166 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101383166 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101383166 (AKT1)
   05135 Yersinia infection
    101383166 (AKT1)
   05152 Tuberculosis
    101383166 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101383166 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    101383166 (AKT1)
   05161 Hepatitis B
    101383166 (AKT1)
   05160 Hepatitis C
    101383166 (AKT1)
   05164 Influenza A
    101383166 (AKT1)
   05162 Measles
    101383166 (AKT1)
   05168 Herpes simplex virus 1 infection
    101383166 (AKT1)
   05163 Human cytomegalovirus infection
    101383166 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101383166 (AKT1)
   05169 Epstein-Barr virus infection
    101383166 (AKT1)
   05165 Human papillomavirus infection
    101383166 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101383166 (AKT1)
   05142 Chagas disease
    101383166 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101383166 (AKT1)
   01524 Platinum drug resistance
    101383166 (AKT1)
   01522 Endocrine resistance
    101383166 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oro01001]
    101383166 (AKT1)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101383166 (AKT1)
Protein kinases [BR:oro01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   101383166 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 101383166
NCBI-ProteinID: XP_004395661
UniProt: A0A2U3VLF0
LinkDB
Position
Unknown
AA seq 480 aa
MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVEQRESPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEEMMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFPEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMLCGRLPFYNQDHEKLFEL
ILMEELRFPRTLSPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFASIVWQDVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQGDNMEGEDSERRPHFPQFSYSASGTA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgaacgacgtggccatcgtgaaggagggttggctgcacaagagaggggagtacatcaaa
acctggcggccccgatacttcctcctcaagaatgatggcacctttattggctacaaggag
cggccccaggacgtcgagcagcgggagtcccctctcaacaacttctctgtggctcaatgt
cagctgatgaagacggagcggcccaggcccaacaccttcatcatccgctgcctgcagtgg
accacggtgatcgagcgcaccttccacgtggagacacccgaagagcgggaggagtggacg
actgccatccagacggtggccgacgggctcaagaggcaggaggaggagatgatggacttc
cggtcgggctcgcccagcgacaactcaggggccgaagagatggaggtgtccctggctaag
cccaagcaccgtgtgaccatgaacgagtttgagtacctgaagctgctggggaagggcacg
ttcgggaaggtgatcctggtgaaggagaaggccacgggccgctactacgccatgaagatc
ctgaagaaggaggtcattgtggccaaggacgaggtcgcccacacgcttacagagaaccgc
gttctccagaactcgaggcatccgttcctgacggccctgaagtactccttccagacccac
gaccgcctctgctttgtcatggagtacgccaacgggggcgagctcttcttccatctgtcc
cgggagcgcgtgttccctgaggaccgggcccgcttctatggcgccgagatcgtgtccgcc
ctggactacctgcactcagagaagaacgtggtctaccgtgacctcaagctggagaacctc
atgctggacaaggacgggcacatcaagatcaccgacttcggcttgtgcaaggagggcatc
aaggacggggccaccatgaagaccttctgtgggacgcccgagtacctggcccccgaggtg
ctggaggacaatgactatggccgggcggtggactggtgggggctgggcgtggtcatgtac
gagatgctgtgcggccggctgcccttctacaaccaggaccatgagaagctcttcgagctc
atcctcatggaggagctccgcttcccgcgcacgctcagccccgaggccaagtccctgctc
tcggggctgctcaagaaggaccccaagcagaggcttggagggggctcagaggacgccaag
gagatcatgcagcatcgcttcttcgccagcatcgtgtggcaggacgtgtatgagaagaag
ctcagtccgcccttcaagccccaggtcacgtcagagacagacaccaggtattttgatgag
gagttcacggctcagatgatcaccatcacgccacccgaccaaggtgacaacatggagggt
gaggacagcgagcggaggccccacttcccgcagttctcttactcggccagcggcacggcc
tga

DBGET integrated database retrieval system