KEGG   Odobenus rosmarus divergens (Pacific walrus): 101374774
Entry
101374774         CDS       T05148                                 

Gene name
ITGAM
Definition
(RefSeq) integrin alpha-M
  KO
K06461  integrin alpha M
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04015  Rap1 signaling pathway
oro04145  Phagosome
oro04514  Cell adhesion molecules
oro04610  Complement and coagulation cascades
oro04640  Hematopoietic cell lineage
oro04670  Leukocyte transendothelial migration
oro04810  Regulation of actin cytoskeleton
oro05133  Pertussis
oro05134  Legionellosis
oro05140  Leishmaniasis
oro05146  Amoebiasis
oro05150  Staphylococcus aureus infection
oro05152  Tuberculosis
oro05202  Transcriptional misregulation in cancer
oro05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101374774 (ITGAM)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101374774 (ITGAM)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101374774 (ITGAM)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101374774 (ITGAM)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101374774 (ITGAM)
   04610 Complement and coagulation cascades
    101374774 (ITGAM)
   04670 Leukocyte transendothelial migration
    101374774 (ITGAM)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101374774 (ITGAM)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101374774 (ITGAM)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101374774 (ITGAM)
   05134 Legionellosis
    101374774 (ITGAM)
   05150 Staphylococcus aureus infection
    101374774 (ITGAM)
   05152 Tuberculosis
    101374774 (ITGAM)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101374774 (ITGAM)
   05140 Leishmaniasis
    101374774 (ITGAM)
Membrane trafficking [BR:oro04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    101374774 (ITGAM)
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101374774 (ITGAM)
Cell adhesion molecules [BR:oro04515]
 Integrins
  Integrin alpha subunits
   101374774 (ITGAM)
CD molecules [BR:oro04090]
 Proteins
  101374774 (ITGAM)
Glycosaminoglycan binding proteins [BR:oro00536]
 Heparan sulfate / Heparin
  Adhesion molecules of cell surface
   101374774 (ITGAM)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 VCBS Integrin_alpha DUF11
Other DBs
NCBI-GeneID: 101374774
NCBI-ProteinID: XP_012423779
UniProt: A0A2U3ZXQ9
LinkDB
Position
Unknown
AA seq 1114 aa
RLGRGSRFVVGAPQEIKAANRTGGLYQCDYSTGKCESMHLQVPLEAVNMSLGLSLAFATR
PFRLLACGPTVHQTCKENTYVNGLCFLFGSNLWQQPQTFPEKLRECPRQDSDIAFLIDGS
GSIIPSDFQRMKNFVSTVMNRFKKSKTLFSLMQFSEDFQTHFTFNEFKKNPHPEFLVKSI
RQLYGKTHTATGILKVVKELFHSSSGARENALKILVVITDGEKFGDPLDYKDVIPEADRA
GIIRYVIGVGDAFNSPKTREELNTIASKPPRDHVFRVNNFEALKTIQNQLQEKIFAIEGT
QTGSTSSFEHEMSQEGFSAAITPNGLLLGAVGSFDWAGGAFLHVSEDKFTFINTTRVDSD
MNDAYLGYAAEVILRSRVQNLVLGAPRYQHIGLVVMFRENAGTWETNASIKGSQIGSYFG
ASLCSVDIDNDGNSDLVLIGAPHYYEQTRGGQVSVCPLPRGRAKWQCGAVLRGEKGHPWG
RFGAAMTVLGDVNGDKLTDVAIGAPGEQENKGAVYLFHGTSGAGISLSHSQWIQGSQVSP
GLQYFGQSLSGGRDLTMDGLVDLAIGAQGHVLLLRSQPVLKLEVTMEFTPKEVARNVFEC
HEKVERGQPAGEVRVCLRVRKNTRDRLREGEIQSNVTYDLALDPRLPHPRVVFDETKNST
RRQIRILKLNQECETLKLLLVYCVEDSVNPIILHFNFSLVGEPMPSFKNLQPMLAVDAQR
HFTALFPFEQNCGSDNICHDDLSITFTFMGLDTLVVGGPRDFNVTLTVRNQGEDSYRTQV
TVFYPPGLSYRRVSVAQKQFSWRRWRLTCEADDSINGPEGLKNSSCSINHPIFPNSSEVT
FNITFGVESDASFGNRLLLKASVTSENNTTRTNKTEFQLELPVKYTVFVVVTSHEVSTKY
LNFIAEEKTSHTIEHKYEFNNLGQRSLPISVVFWVPIKLNQVTVWDNPQVTFSKNLSSTC
HTKEREPPLSDFLVELKKTPVVNCSIAFCQRIQCDIVSFGIQEKVNITLQGKLSFDWYIK
TSTNYLQVVSTAEVLFDNLKFALLPGQEAFLRAQTETKVEPNEVHNPLPLIVGSSVGGLV
LLALIIAGLYKLGFFKRQYKDMMSEAGPDAAQPQ
NT seq 3345 nt   +upstreamnt  +downstreamnt
cgactgggccgtggatcacggtttgtggttggagccccccaggagataaaggctgccaac
cgaacaggtggcctctaccaatgtgactacagcacgggcaagtgtgagtccatgcacctg
caggtccccctggaggcggtgaacatgtctctgggcctgtctctggcatttgccaccaga
cctttccgactgctggcctgtggccccactgtgcaccaaacttgtaaggagaatacctat
gtgaacggcttatgcttcctgtttggatccaacctatggcagcagccccagactttccca
gagaagctcagagagtgccctcggcaggacagtgatattgccttcttgattgatggctct
ggtagcatcatcccgagtgactttcagcggatgaagaactttgtctcaactgtcatgaat
cgattcaagaagtccaaaaccttgttttctttgatgcagttctctgaagacttccagact
catttcaccttcaatgagttcaagaaaaaccctcacccagaatttctggtgaaatcaata
agacagctatacgggaagacacacactgccacaggaatcctcaaagtagtaaaagaactg
tttcatagcagtagtggagcccgggagaatgcccttaagatcctagttgtcatcacagat
ggagaaaagtttggtgatcccttggattacaaggatgtcatccccgaagcagacagagcg
gggatcattcgctatgtcattggggtgggtgatgctttcaacagtccaaaaactcgtgaa
gagcttaataccattgcatccaagcctcctcgtgatcatgtgttccgggtaaataacttt
gaagctctgaagaccattcaaaaccagcttcaggaaaagatctttgcaattgagggtact
cagacaggaagtaccagctcctttgagcatgagatgtctcaggaaggcttcagtgctgcc
atcacccctaatggtctcttgctaggtgctgtggggagctttgactgggctggtggagcc
tttcttcatgtgtcagaggataaatttaccttcatcaacacaaccagggtagattcagac
atgaacgatgcttacttgggttatgctgctgaagtcatcttgaggagcagggtacaaaac
ctggttcttggggcacctcgatatcagcacattggcctggtggtgatgttcagagagaat
gctggtacctgggagaccaatgcatctatcaagggcagccagattggctcctactttgga
gcctccctctgctctgtggacatcgataatgatggcaactctgacttggtcctcatcggg
gccccccattactacgagcagacaaggggaggtcaggtgtctgtgtgccccttgcctcgg
gggagggctaagtggcagtgtggggctgttctccgtggggagaagggccacccctggggc
cgctttggggcagccatgacagtgctgggagacgtgaatggggacaagctgacagacgtg
gccatcggggccccaggagagcaggagaacaagggtgctgtctacctatttcatggaacc
tcaggagcgggcatcagtctgtctcacagccagtggattcaaggctcccaggtctcccct
gggctccagtattttggtcagtcactaagtgggggccgggacctcacaatggatggactg
gtggacctggctataggggcccaaggccatgtgctgctgctcagatcccagcctgtgctg
aaacttgaggtgaccatggagttcacacccaaggaagtggcaaggaatgtgtttgagtgt
catgaaaaggtggagagaggtcagcctgctggagaggtcagagtttgcctccgtgtccgc
aagaacacacgggaccgactaagagaaggagagatccagagcaatgttacatatgacctg
gctctggacccacgtctcccacatccccgagttgtctttgatgagacaaagaacagcaca
cgcagacagataaggatcttgaagctgaatcaagaatgtgaaaccctaaagctactgtta
gtgtattgtgtagaggactcagtgaaccccatcatcctgcacttcaacttctctctggtg
ggggagcccatgccctcattcaagaacctccagccaatgctggctgtggatgctcagaga
cacttcacagctttgtttccctttgagcagaattgtggcagtgacaacatttgccatgat
gacctcagcatcaccttcacttttatgggcctggacaccctggtagtgggtggtccccga
gacttcaatgtgacactgactgtgagaaaccagggtgaggactcctacaggactcaggtc
actgtcttctacccacctggcttatcctatcggagggtgtcagtggcccagaagcagttc
tcatggcgacgttggcgcctgacttgtgaggctgatgactccatcaatgggcctgagggc
ttgaagaatagcagctgcagcattaaccaccccatcttcccaaactcctcagaggtcact
tttaatatcacatttggtgtggaatctgatgcttcctttggaaacagattactcctcaag
gccagtgtgacgagtgagaacaacacgacaaggaccaacaaaactgaattccagctggag
ctgcctgtgaaatacacggtctttgtggtagtcaccagccatgaggtctccaccaaatat
ctcaacttcatagctgaggagaagaccagccacactatagagcataaatatgagttcaac
aacttggggcagaggagcctccccatcagtgtggtcttctgggtgcctatcaagctgaac
caagtgactgtgtgggacaacccccaggtcaccttttccaagaacctctccagcacatgc
cacaccaaggagagggaaccccctctctctgacttcctggtggagcttaagaagactcca
gttgtgaactgctccattgctttctgccagagaatccagtgtgacattgtgtcctttggc
atccaggaaaaagtcaatatcaccctccaaggcaaactttcgtttgactggtatatcaaa
acttcaacaaactaccttcaggttgtgagcacggcagaggtcttatttgataatttgaag
tttgccctgcttccaggacaggaggcatttctgagggcccagacagaaaccaaagtggag
ccaaatgaagtgcacaaccctctaccacttatagtgggcagctcagtgggggggctggtg
cttctggccctcatcatcgctggactgtacaagctcggcttcttcaaacggcagtacaag
gacatgatgagtgaagctggtcccgatgctgcccagccccagtaa

DBGET integrated database retrieval system