KEGG   Odobenus rosmarus divergens (Pacific walrus): 101375107
Entry
101375107         CDS       T05148                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01522  Endocrine resistance
oro01524  Platinum drug resistance
oro04012  ErbB signaling pathway
oro04066  HIF-1 signaling pathway
oro04068  FoxO signaling pathway
oro04110  Cell cycle
oro04115  p53 signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04218  Cellular senescence
oro04630  JAK-STAT signaling pathway
oro04921  Oxytocin signaling pathway
oro04928  Parathyroid hormone synthesis, secretion and action
oro04934  Cushing syndrome
oro05160  Hepatitis C
oro05161  Hepatitis B
oro05163  Human cytomegalovirus infection
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05169  Epstein-Barr virus infection
oro05200  Pathways in cancer
oro05202  Transcriptional misregulation in cancer
oro05203  Viral carcinogenesis
oro05205  Proteoglycans in cancer
oro05206  MicroRNAs in cancer
oro05210  Colorectal cancer
oro05211  Renal cell carcinoma
oro05212  Pancreatic cancer
oro05213  Endometrial cancer
oro05214  Glioma
oro05215  Prostate cancer
oro05216  Thyroid cancer
oro05217  Basal cell carcinoma
oro05218  Melanoma
oro05219  Bladder cancer
oro05220  Chronic myeloid leukemia
oro05222  Small cell lung cancer
oro05223  Non-small cell lung cancer
oro05224  Breast cancer
oro05225  Hepatocellular carcinoma
oro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101375107 (CDKN1A)
   04630 JAK-STAT signaling pathway
    101375107 (CDKN1A)
   04066 HIF-1 signaling pathway
    101375107 (CDKN1A)
   04068 FoxO signaling pathway
    101375107 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    101375107 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101375107 (CDKN1A)
   04115 p53 signaling pathway
    101375107 (CDKN1A)
   04218 Cellular senescence
    101375107 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101375107 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    101375107 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101375107 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    101375107 (CDKN1A)
   05206 MicroRNAs in cancer
    101375107 (CDKN1A)
   05205 Proteoglycans in cancer
    101375107 (CDKN1A)
   05203 Viral carcinogenesis
    101375107 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101375107 (CDKN1A)
   05212 Pancreatic cancer
    101375107 (CDKN1A)
   05225 Hepatocellular carcinoma
    101375107 (CDKN1A)
   05226 Gastric cancer
    101375107 (CDKN1A)
   05214 Glioma
    101375107 (CDKN1A)
   05216 Thyroid cancer
    101375107 (CDKN1A)
   05220 Chronic myeloid leukemia
    101375107 (CDKN1A)
   05217 Basal cell carcinoma
    101375107 (CDKN1A)
   05218 Melanoma
    101375107 (CDKN1A)
   05211 Renal cell carcinoma
    101375107 (CDKN1A)
   05219 Bladder cancer
    101375107 (CDKN1A)
   05215 Prostate cancer
    101375107 (CDKN1A)
   05213 Endometrial cancer
    101375107 (CDKN1A)
   05224 Breast cancer
    101375107 (CDKN1A)
   05222 Small cell lung cancer
    101375107 (CDKN1A)
   05223 Non-small cell lung cancer
    101375107 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101375107 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101375107 (CDKN1A)
   05161 Hepatitis B
    101375107 (CDKN1A)
   05160 Hepatitis C
    101375107 (CDKN1A)
   05163 Human cytomegalovirus infection
    101375107 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101375107 (CDKN1A)
   05169 Epstein-Barr virus infection
    101375107 (CDKN1A)
   05165 Human papillomavirus infection
    101375107 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101375107 (CDKN1A)
   01522 Endocrine resistance
    101375107 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 101375107
NCBI-ProteinID: XP_004409845
UniProt: A0A2U3ZRB0
LinkDB
Position
Unknown
AA seq 161 aa
MAEPSRDAQQIPRGSKACRRLFGPVDSEQLRRDCDALMAGCVQEARERWNFDFVTETPLE
GDFAWERVWGLGLPKLYLPAGPRDDLGGGKRPSPSPALLQGTAQEDHLDLSLTCTLMPHT
LERPEGSPGAPGTSQGRKRRQTSMTDFYHSKRRLIFSKRKP
NT seq 486 nt   +upstreamnt  +downstreamnt
atggcggaaccgtccagggatgcccagcagatcccgcgtggaagcaaggcttgccgccgc
ctcttcggccccgtggacagtgagcagctgcgccgagactgtgacgcactgatggccggc
tgcgtgcaggaggcccgggagcgatggaacttcgactttgtcaccgagacaccgctggag
ggcgactttgcctgggagcgcgtgtggggcctgggcctgcccaagctctacctgcctgcg
gggccccgggatgacctgggagggggcaagcggcccagcccctcacctgccctgctgcag
gggaccgctcaggaggaccacctggacctgtcgctgacctgcaccctcatgcctcacacc
cttgagcggcctgaggggtccccgggggcacctggcacctctcagggccgaaaacggcgg
cagaccagcatgacagatttctatcactccaaacgccggctgatcttctccaagaggaag
ccctaa

DBGET integrated database retrieval system