KEGG   Odobenus rosmarus divergens (Pacific walrus): 101375181
Entry
101375181         CDS       T05148                                 

Gene name
IL9R
Definition
(RefSeq) interleukin-9 receptor
  KO
K05073  interleukin 9 receptor
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04060  Cytokine-cytokine receptor interaction
oro04630  JAK-STAT signaling pathway
oro04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101375181 (IL9R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101375181 (IL9R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101375181 (IL9R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:oro04050]
    101375181 (IL9R)
   04090 CD molecules [BR:oro04090]
    101375181 (IL9R)
Cytokine receptors [BR:oro04050]
 Interleukin receptor families
  IL2 receptor family
   101375181 (IL9R)
CD molecules [BR:oro04090]
 Proteins
  101375181 (IL9R)
SSDB
Other DBs
NCBI-GeneID: 101375181
NCBI-ProteinID: XP_004403318
UniProt: A0A2U3W5G2
LinkDB
Position
Unknown
AA seq 523 aa
MEPSRCIWEGWTLESEALMRELSTWLLICTCFSSWVGLGDSVQGEEGGLGAGSFTCLSNN
ILRIDCHWSAPELGQGPSPWLLFTSNHAPGSKHRCVFRAGECTLVLPPEEVLVPSDNFTI
TFHRYVSGREQVSLVDLQYLPWRHVKLDPPSDLQSNVSSDYCVLTWSVSPALEPLTSLLS
YELAFKKQEEAWEQARHRAHIAGVTWLTLEAAELDPGSSYEARLRVQMATPEDETVEEQS
YAGQWSEWSQSVCFPSPQSPARGPLFSPWGQPNSSTLVAVPLFLLLTSLTYLVFKLSPRV
KRSFYRNVPSPGAFFQSLYSVHNGDFQTWIGAHRTGLLPSQDCVGSPRGASESGVQEAIA
WLTYDPADPWQSVALEEEEEGPGSGLPGAVLLAGHVEQRGQPPPYLPQEDWAPASPSRPA
SPQSEGSSGDYWALGCSGGCHPSTFPGNTQSSGPSPASARGLSCDQQNLDTGEEVSWLLA
GRGAQGRDLALGRSMSLRPLGGCVMVGEPRLPLQDEQYLLVLL
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggagcccagcagatgcatctgggaaggatggaccttggagagtgaggccctgatgcga
gagttgagcacctggctcctgatctgcacctgcttcagctcttgggttggcttgggagac
tccgtccaaggagaagaaggagggctcggggctggatctttcacctgcctcagcaacaac
atcttaaggattgactgccactggtctgccccagagctgggtcagggccccagtccctgg
cttctctttaccagcaaccacgcaccgggcagcaagcatagatgtgtcttccgggccggt
gagtgcaccctggtgctgccgcctgaggaagtgcttgtgccttcagacaacttcaccatc
actttccaccgttacgtctctgggagggagcaggtcagcctggtggacctgcagtacctg
ccctggagacatgtgaagttggaccctccctctgacttacagagtaatgtcagctctgac
tactgtgtcctcacctggagcgtcagtcctgccttggagcccctgacctccctcctcagc
tacgagctggccttcaagaagcaggaagaggcctgggagcaggcccggcacagggctcac
attgccggggtgacctggctcaccctcgaggctgctgagctggaccccggttccagctat
gaggcccgcctgcgtgtccagatggccaccccggaggatgaaacagtggaggagcagagc
tatgctggccagtggagcgaatggagccagtctgtgtgcttcccttctccccagagccct
gcccgaggccccctgttctcaccttgggggcagcccaacagcagcacccttgttgccgta
cctctctttctgctgctgaccagcctgacctacctcgtgttcaagctttcacccagggtg
aagaggagcttctaccgcaacgtgccctctccaggggccttcttccagtccctctacagt
gtgcacaatggggacttccagacctggataggggcccacagaaccggtctgctgccgagc
caggactgtgtcgggtccccacgaggagcctcggagtctggtgtccaggaggccattgcg
tggctgacgtacgacccagcggatccctggcagtcagtggccctggaggaagaggaggag
ggccctggctccggcctccctggggcggtgctgctagccggccacgtggaacagagaggg
cagccacctccctacctgccccaggaggactgggcccccgcgagccccagcaggccagct
tccccacagtcagagggcagcagtggtgactactgggccctgggctgctccgggggctgc
cacccctccaccttcccaggaaacacccagagctcggggcccagcccggcctcggcccgt
ggcctttcttgtgaccagcagaatctggacactggcgaggaagtaagctggctgctggcc
gggagaggggcccaggggagagacctggctttgggccggagcatgagcctgcggcccctt
ggaggctgtgtgatggtaggtgagccacgcctgccccttcaggacgaacaatacctcctt
gtgttgctgtga

DBGET integrated database retrieval system