KEGG   Odobenus rosmarus divergens (Pacific walrus): 101375348
Entry
101375348         CDS       T05148                                 

Gene name
CD19
Definition
(RefSeq) B-lymphocyte antigen CD19 isoform X2
  KO
K06465  B-lymphocyte antigen CD19
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04151  PI3K-Akt signaling pathway
oro04640  Hematopoietic cell lineage
oro04662  B cell receptor signaling pathway
oro05169  Epstein-Barr virus infection
oro05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101375348 (CD19)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101375348 (CD19)
   04662 B cell receptor signaling pathway
    101375348 (CD19)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    101375348 (CD19)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101375348 (CD19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:oro04090]
    101375348 (CD19)
CD molecules [BR:oro04090]
 Proteins
  101375348 (CD19)
SSDB
Motif
Pfam: V-set ig Ig_3 Ig_2
Other DBs
NCBI-GeneID: 101375348
NCBI-ProteinID: XP_004397201
UniProt: A0A2U3VPW4
LinkDB
Position
Unknown
AA seq 560 aa
MPPPLLLFFLLFLTPEGVRPQKTLLVEAKEGGKAELPCLKGPSDGRPKQQAWFQGSQAEL
GHRSQGLGIQKGSLGVQLFVFNVSDQMGGFYLCQLGSPSEQAWQSGWTVSVEGSGELFRW
NASALNDSGCGLGNRSSEGPKPSSGYPTSSQLYVWAKDHPEIWEIDPECALPRGSLNQSL
NQDLTVAPGSTFWLPCEVPPASVARGPISWTHVRPKKHNISLLSLNLRENDPGREIWVLG
TLRGGAVLLLPQATVRDAGIYRCYHGNMTINMQLKVIAQSAVRYWLLETGGWKVLVVPLL
YLIFCLGSLVSFLHLRRALILRRKRKRMTDPTRRFFKVTPPPGSGAQNQYGNVLSLPTPS
SGTGRALRWAAGLGAAVQSYGSPRSEVPEPGAAGSRSPPPAGPEEEEGEAYEEPDSEEGS
EFYENDSNRGQDQLSQDGSGYENPENGALGPEDEDSFSSAESYENEDEELAQPVTRTVDF
LSPHGSAWDPSREATSLGSQSYEDMRGILYAAPQLRSIRAQPGPNHEEDADSYENMDMDN
PNGPEPAWGGGGHMGTWSTR
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgccacctcctctccttctcttcttcctcctcttcctcacacccgagggagtcaggccc
cagaaaacactgctggtggaggctaaagagggaggcaaagctgagctgccatgcctcaaa
ggtccctcagatggtcgtcctaagcagcaggcctggtttcaggggtctcaggcagagctg
ggccacaggtcccaaggcctgggcatccagaaggggtcccttggcgtccagctgttcgtc
ttcaacgtctctgaccagatggggggcttctacctgtgccagctagggtctccttccgag
caggcgtggcagtctggctggacagtcagcgtggaaggcagtggggagctgttccggtgg
aatgcttcggccctaaatgactcaggctgtgggctggggaacaggtcctcagagggcccc
aagccctcttctggttatcccacaagctcccagctgtatgtgtgggccaaagaccaccct
gagatctgggagatagaccctgaatgtgccctgcccaggggcagtctgaaccagagcctc
aaccaagacctcaccgtggcccctggctccacattctggctgccctgtgaggtgccccct
gcctccgtggccagaggccccatctcctggacccacgtgcgccctaagaagcataacatc
tccttgctgagcttaaacctgagggagaatgacccaggcagagagatatgggtcctgggc
accctcaggggaggggctgttctgttgctgccccaggccacagttcgagatgctggcatc
tatcgttgttatcatggcaacatgaccatcaacatgcagctgaaggtcattgcccagtca
gcagtaaggtattggctgctagagactggtggctggaaagtccttgttgtgccattactt
tatctgatcttctgcctgggttccctggtgagctttcttcatcttcgaagagccctgatc
ctcaggaggaaaagaaagcgaatgacagatcccaccagaaggttcttcaaagtgacgcct
cccccgggaagcggggcccagaatcagtatgggaacgtgctctcccttcccacgccctcc
tctggcaccggacgcgccctgaggtgggctgcaggcctgggggccgccgtgcagtcttac
ggaagcccgcgcagcgaagtgccggagcccggagccgcggggtcccggagcccgccgccg
gcaggcccagaagaagaggaaggagaggcctatgaggagccagacagtgaggagggctcc
gagttctacgagaacgactccaaccgtgggcaggaccaactctcccaggatggcagcggc
tatgagaaccctgagaatggggccttgggtcctgaggatgaagactccttctccagcgcc
gagtcttacgagaatgaagatgaagagctggcccagccagtcaccaggacagtagacttc
ctgagcccccatgggtcagcctgggaccccagcagggaagcaacctctcttggctcccag
tcgtacgaggatatgagagggatcctgtatgcagccccccagctccgctccattcgggcc
cagcctggtcccaaccatgaggaagatgcagactcctatgagaacatggacatggataat
cccaatgggccagaaccagcatggggaggaggaggccacatgggcacctggagcactaga
tga

DBGET integrated database retrieval system