KEGG   Odobenus rosmarus divergens (Pacific walrus): 101375422
Entry
101375422         CDS       T05148                                 

Gene name
BAD
Definition
(RefSeq) bcl2-associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01521  EGFR tyrosine kinase inhibitor resistance
oro01522  Endocrine resistance
oro01524  Platinum drug resistance
oro04012  ErbB signaling pathway
oro04014  Ras signaling pathway
oro04022  cGMP-PKG signaling pathway
oro04024  cAMP signaling pathway
oro04062  Chemokine signaling pathway
oro04140  Autophagy - animal
oro04151  PI3K-Akt signaling pathway
oro04210  Apoptosis
oro04370  VEGF signaling pathway
oro04510  Focal adhesion
oro04722  Neurotrophin signaling pathway
oro04910  Insulin signaling pathway
oro04919  Thyroid hormone signaling pathway
oro05010  Alzheimer disease
oro05014  Amyotrophic lateral sclerosis
oro05020  Prion disease
oro05022  Pathways of neurodegeneration - multiple diseases
oro05145  Toxoplasmosis
oro05152  Tuberculosis
oro05160  Hepatitis C
oro05161  Hepatitis B
oro05162  Measles
oro05165  Human papillomavirus infection
oro05168  Herpes simplex virus 1 infection
oro05170  Human immunodeficiency virus 1 infection
oro05200  Pathways in cancer
oro05203  Viral carcinogenesis
oro05210  Colorectal cancer
oro05211  Renal cell carcinoma
oro05212  Pancreatic cancer
oro05213  Endometrial cancer
oro05215  Prostate cancer
oro05218  Melanoma
oro05220  Chronic myeloid leukemia
oro05221  Acute myeloid leukemia
oro05223  Non-small cell lung cancer
oro05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101375422 (BAD)
   04014 Ras signaling pathway
    101375422 (BAD)
   04370 VEGF signaling pathway
    101375422 (BAD)
   04024 cAMP signaling pathway
    101375422 (BAD)
   04022 cGMP-PKG signaling pathway
    101375422 (BAD)
   04151 PI3K-Akt signaling pathway
    101375422 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101375422 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    101375422 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101375422 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101375422 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101375422 (BAD)
   04919 Thyroid hormone signaling pathway
    101375422 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101375422 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101375422 (BAD)
   05203 Viral carcinogenesis
    101375422 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101375422 (BAD)
   05212 Pancreatic cancer
    101375422 (BAD)
   05225 Hepatocellular carcinoma
    101375422 (BAD)
   05221 Acute myeloid leukemia
    101375422 (BAD)
   05220 Chronic myeloid leukemia
    101375422 (BAD)
   05218 Melanoma
    101375422 (BAD)
   05211 Renal cell carcinoma
    101375422 (BAD)
   05215 Prostate cancer
    101375422 (BAD)
   05213 Endometrial cancer
    101375422 (BAD)
   05223 Non-small cell lung cancer
    101375422 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101375422 (BAD)
   05014 Amyotrophic lateral sclerosis
    101375422 (BAD)
   05020 Prion disease
    101375422 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    101375422 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101375422 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101375422 (BAD)
   05161 Hepatitis B
    101375422 (BAD)
   05160 Hepatitis C
    101375422 (BAD)
   05162 Measles
    101375422 (BAD)
   05168 Herpes simplex virus 1 infection
    101375422 (BAD)
   05165 Human papillomavirus infection
    101375422 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101375422 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101375422 (BAD)
   01524 Platinum drug resistance
    101375422 (BAD)
   01522 Endocrine resistance
    101375422 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 101375422
NCBI-ProteinID: XP_004394061
UniProt: A0A2U3VHE9
LinkDB
Position
Unknown
AA seq 168 aa
MFQIPEFEPSEQEDSSPADRGLGPSPTGDRPPGPGKHRQTAPGLLGEAGHQQGQPASSNH
HGGAGAVETRSRHSSYPAGSEEDEGMEEEELSPFRGRSSSAPPNLCAALRYGRELRRMSD
EFQGSFKGLPRPRSAGTATQMRQSPSWTRVIQSWWDRNLGRGGSAPSQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagcccagtgagcaggaagactccagtcctgcagatagg
ggcctgggccccagccccacaggggaccggcccccaggccctggtaagcaccggcagacg
gccccaggcctcctaggggaagctggtcaccagcaggggcagccggccagcagcaaccac
catggaggcgctggggctgtggagacccggagtcgccacagctcgtaccccgcggggtcc
gaggaggatgaagggatggaggaggaagagctcagccctttccgggggcgctcgagctca
gcgccccccaacctctgtgctgcactgcgctatggccgcgagctccggaggatgagcgac
gagttccagggctccttcaagggacttcctcgcccgaggagcgcgggcacagcgacgcag
atgcgacaaagccccagctggacgcgcgtcatccagtcctggtgggatcggaacttgggg
agaggaggctccgccccctcccaatga

DBGET integrated database retrieval system