KEGG   Odobenus rosmarus divergens (Pacific walrus): 101375484Help
Entry
101375484         CDS       T05148                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00590  Arachidonic acid metabolism
oro01100  Metabolic pathways
oro04064  NF-kappa B signaling pathway
oro04370  VEGF signaling pathway
oro04625  C-type lectin receptor signaling pathway
oro04657  IL-17 signaling pathway
oro04668  TNF signaling pathway
oro04723  Retrograde endocannabinoid signaling
oro04726  Serotonergic synapse
oro04913  Ovarian steroidogenesis
oro04921  Oxytocin signaling pathway
oro04923  Regulation of lipolysis in adipocytes
oro05140  Leishmaniasis
oro05163  Human cytomegalovirus infection
oro05165  Human papillomavirus infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05200  Pathways in cancer
oro05204  Chemical carcinogenesis
oro05206  MicroRNAs in cancer
oro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    101375484 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    101375484 (PTGS2)
   04064 NF-kappa B signaling pathway
    101375484 (PTGS2)
   04668 TNF signaling pathway
    101375484 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101375484 (PTGS2)
   04657 IL-17 signaling pathway
    101375484 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    101375484 (PTGS2)
   04913 Ovarian Steroidogenesis
    101375484 (PTGS2)
   04921 Oxytocin signaling pathway
    101375484 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    101375484 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    101375484 (PTGS2)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    101375484 (PTGS2)
   05206 MicroRNAs in cancer
    101375484 (PTGS2)
   05204 Chemical carcinogenesis
    101375484 (PTGS2)
   05222 Small cell lung cancer
    101375484 (PTGS2)
  09167 Infectious diseases
   05163 Human cytomegalovirus infection
    101375484 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101375484 (PTGS2)
   05165 Human papillomavirus infection
    101375484 (PTGS2)
   05140 Leishmaniasis
    101375484 (PTGS2)
Enzymes [BR:oro01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     101375484 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 101375484
NCBI-ProteinID: XP_004405789
UniProt: A0A2U3WBH8
LinkDB All DBs
Position
Unknown
AA seq 604 aa AA seqDB search
MLARALLLFAALALCRAANPCCSNPCQNQGVCMSIGFDQYRCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYILTHFKGVWNIVNNIPFLRNVIMKYVLTSRSHLIESPPTYNVDY
GYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGKKELPDSKEIVEKFLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDHKRGPAFTKGLGHGVDLSHIYGETLDRQHKLRLFKDGKMKY
QVIDGEVYPPTVKDTQVEMIYPPHVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYYFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDTLQIDDQEYNFQQFIYNNSILLEHGLTQFVESFSRQIAGRV
AGGRNVPAAVQQVAKASIDQSRQMKYQSLNEYRKRFRLKPYASFEELTGEKEMAAGLEAL
YGDIDAMELYPALLLEKPRPDAIFGETMVEMGAPFSLKGLMGNPICSPDYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPFTAFSVQDPQLTKTVTINASSSHSGLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctcgcgccctgctgctcttcgccgccctggcgctctgccgtgcagctaatccg
tgctgttccaacccatgtcaaaaccaaggtgtatgtatgagcataggatttgaccagtat
agatgtgactgcactcgaacaggattctatggcgaaaactgttcaacacctgaatttctg
acaagaataaaattattcctgaaacccactccaaatacagtgcactacatacttacccac
ttcaagggagtctggaacattgtcaataacattcccttcctgcgaaatgtaattatgaaa
tacgtgttgacatccaggtcacatttgattgagagtccaccaacttacaacgtggactat
ggctataaaagctgggaagccttctccaatctctcctactacaccagagctcttccccct
gtggctgatgactgtccaacacccatgggtgtgaaaggcaagaaagagcttcctgattca
aaagagattgtggaaaaatttcttctaagaagaaagttcattcctgatccccagggcaca
aatatgatgtttgcattctttgcccagcacttcacccatcaatttttcaagacagatcat
aagcgagggccagctttcaccaaaggactgggccatggggtggacttaagccatatttat
ggggaaactttggatagacaacataaactgcgccttttcaaggatggaaaaatgaaatat
caggtaattgatggagaggtgtatcctcccacagtcaaagatactcaggtggagatgatc
tacccaccccatgttcctgaacacctacggtttgctgtgggccaggaagtcttcgggctg
gtgcctggtctgatgatgtacgccacaatttggctacgggaacacaacagagtgtgcgat
gtgcttaaacaggagcatccagagtgggatgatgagcggctattccagacgagcaggctc
atactgataggagaaaccattaagattgtgattgaagactacgtacagcacttgagcggc
tattacttcaagctgaagtttgacccagagctgcttttcaaccaacaattccagtaccaa
aaccgtattgctgctgagtttaacacactctaccactggcatccccttctgcctgacacc
ttgcaaatagatgaccaggagtacaatttccagcagtttatctacaacaactctatattg
ctggaacatgggcttacccagtttgtggagtcattcagcaggcagattgccggcagggtt
gctggtggtaggaatgttccagctgcagtacaacaagtagcaaaggcctcaatcgaccag
agcagacagatgaaataccagtctcttaatgagtatcgcaaacgctttcggctgaagccc
tatgcctcgttcgaagaacttacaggagagaaggaaatggctgcggggttagaggccctt
tatggtgatattgatgccatggaactgtatcctgccctcctgctagaaaagcctcgtcca
gatgccatctttggtgagaccatggtagaaatgggagcgccattctccttgaaaggactt
atgggtaatcccatctgttcccctgactactggaagcctagcacttttggtggagaagta
ggctttaaaatcatcaacactgcctcaattcagtctctcatctgcaataacgtgaagggc
tgtccttttactgcattcagtgttcaagacccacagctcaccaaaacagtcaccattaat
gcaagctcttcacactccggactagatgatatcaatcccacagtcctactaaaagaacgg
tccactgaactgtaa

DBGET integrated database retrieval system