KEGG   Odobenus rosmarus divergens (Pacific walrus): 101375610Help
Entry
101375610         CDS       T05148                                 

Gene name
SUV420H1
Definition
(RefSeq) histone-lysine N-methyltransferase SUV420H1 isoform X1
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101375610 (SUV420H1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oro03036]
    101375610 (SUV420H1)
Enzymes [BR:oro01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101375610 (SUV420H1)
Chromosome and associated proteins [BR:oro03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101375610 (SUV420H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 101375610
NCBI-ProteinID: XP_004393873
UniProt: A0A2U3VGI4
LinkDB All DBs
Position
Unknown
AA seq 935 aa AA seqDB search
MVFYVFTSWFFPYFVSVRRERWNYSLSYLKRATQCTWVRRSVGMKWLGESKNMVVNGRRS
GGKLSNDHQQSPSKLQHAGKEATKAGKHAVERRSSRCNGNSGFEGQSRYVPSSGMSAKEL
CENDDLATSLVLDPYLGFQTHKMNTSAFPSRSSRHFSKSDSFPHNNPVRFRPIKGRQEEL
KEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKEHVFIYLRMFATDSGFEI
LPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEENMLLRHGENDFSVMYSTR
KNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNE
FCECYTCERRGTGAFKSRVGLPAPAPVINSKYGLRETDKRLNRLKKLGDSSKNSDSQSVS
SNTDADTTQEKNNATPNRKSSVGVKKNSKSRTLTRQSMSRIPASSNSTSSKLTHINNSRV
PKKLKKPAKPLLSKIKLRNHCKRLEQKSASRKLEMGSLVLKEPKVVLYKNLPIKKEKEPE
GPVQATAASGCLTRHAAREHRAGSGRGPPSGDGAPCTYTTRRSARARVTPREPCDGPQEP
SASDGSKSSSAGPCPDGGERPAPAAPEDGLAPGAAQKREAKCQRGDSGPSKKKSRQGKLV
RQLARAEEPAAGQECPGQAGVAPEVLASRCEPGERRAPEPEPAPGSYADWAPSPGGVGGG
GGGGGSVVTSDGFRTKDGFRTAKSKKKRRITRYDAQLILENNSGIPKLTLRRRHDSSSKT
NDQENDGTNSSKISIKLSKDHENDNNLYVAKLNNGFNSGSGSSSTKLKIQLKRDEEGRGP
CSEGLHENGLCCGDPLSLLESRVEVDDYGQYEAGSTEEPSSSEADAADEDYEEDFEDDFI
PLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atggtcttttatgtatttacctcctggttttttccgtattttgtttctgtcaggagagaa
cgttggaattattctttgagctatctgaagagagcgactcaatgcacctgggtcaggcgg
tctgtgggcatgaagtggttgggagaatccaagaacatggtggtgaatggcaggaggagt
ggaggcaagttgtctaatgaccatcagcagagtccatcaaaattgcagcacgcggggaag
gaggccacgaaggctggcaaacacgcagttgagaggaggtcgagcagatgtaatggtaat
tcgggatttgaaggacagagtcgatatgtaccatcttctggaatgtctgccaaggaactc
tgtgagaatgatgatctggcgaccagtttggttcttgatccctatttaggttttcaaaca
cacaaaatgaatactagcgcctttccttcgaggagctcaaggcatttttcaaaatctgac
agttttcctcacaacaaccctgtgagatttcgacctattaagggaaggcaagaagaacta
aaggaagtcattgaacgttttaagaaagatgaacacttggagaaagccttcaaatgtttg
acttcaggcgaatgggcacggcattattttctcaacaagaacaaaatgcaggagaaatta
ttcaaggaacatgtatttatttacttgcgaatgtttgcaactgacagtggatttgaaata
ctgccttgtaatagatactcgtccgaacaaaatggagccaaaatcgttgcaacgaaagag
tggaaacgaaatgacaaaatagaattactggtgggttgtattgccgaactttcagaaatt
gaggagaacatgctacttagacacggagaaaacgacttcagtgtcatgtattccacaagg
aaaaactgtgctcagctctggctcggccccgccgcctttataaaccatgattgcagacct
aactgcaagtttgtgtcgactggtcgagatacggcgtgtgtgaaggccctgagagacatt
gagcctggagaagagatttcttgttattacggagacgggttttttggagaaaataatgag
ttctgcgagtgttacacttgcgaaagacggggaaccggtgcttttaaatccagagtggga
ctgcctgcacctgctcctgttatcaatagcaaatatggactcagagagacagataaacgc
ttaaataggcttaaaaagttaggtgacagcagcaaaaactcagacagtcaatctgtcagc
tctaacactgatgcagataccactcaggaaaaaaacaatgcaactcctaaccgaaaatct
tcagttggtgtgaaaaagaacagcaagagcagaacattgacaaggcaatctatgtcaaga
attccagcttcttccaactctacctcatctaagctaactcatataaataattccagggta
ccaaagaaactgaaaaagcctgcaaagcctttactttccaagataaaactaagaaatcat
tgcaagcggctggagcaaaagagtgcttcaagaaaactcgagatgggaagcttagtactc
aaagagcccaaagtagttctgtataaaaacttacccattaaaaaagagaaggagcccgag
ggaccagttcaagccacagcagctagcgggtgcttaactagacacgcggcgcgggagcac
cgagcgggctccgggcgcggcccgccgtcgggggacggcgccccctgcacctacaccacc
aggcggtcggcgcgggcgagggtgactccgagggagccttgtgacggcccgcaggagccg
agcgcgtcggacggctctaagagcagctcggcgggaccttgccccgacggcggcgagcgg
ccggctcccgcggcgccggaggacggcctggctcccggggcggcacaaaagcgggaagcc
aagtgtcagaggggcgacagcggcccgtcgaagaagaagtcgcggcaagggaaactcgtg
aggcagttggcgagagccgaggagcccgccgcggggcaggagtgccccggacaggcgggc
gtggcgcccgaggtgctggcgtcccgctgcgagccgggcgagcgccgcgcccccgagccc
gagccggcgcccggcagctacgcggactgggctccctcgcccggcggcgttggcggcggc
ggcggcggcggcgggtcggtcgtcacgtccgacggcttccgaacaaaagacggcttccga
actgcaaaaagtaaaaagaagaggcgaatcacgaggtatgacgcccagctgatcctggag
aataactctgggattcccaaattgactcttcgtcggcgtcacgacagcagcagcaagaca
aacgaccaagagaatgacggcacgaattcttcaaaaataagcatcaagttaagtaaagac
cacgaaaacgataacaatctgtatgtagcaaagctcaataatgggtttaactcagggtcg
ggcagcagctccacgaagctcaagatccagctgaagcgggacgaggagggccgggggccg
tgctcggaggggctccacgagaacgggctgtgctgcggcgacccgctctcgctgctggag
tcccgcgtggaggtggacgactacggccagtacgaggcggggagcacggaggagccctcc
tcctccgaggccgacgcggcggacgaggactacgaggaggacttcgaggacgacttcatc
cctctgcccccagccaagcgcctgcggctcatagtcggcaaggactccatagacattgac
atttcttcccggagaagggaagaccagtctctgaggctcaacgcgtga

DBGET integrated database retrieval system