KEGG   Odobenus rosmarus divergens (Pacific walrus): 101375792Help
Entry
101375792         CDS       T05148                                 

Gene name
SLC12A8
Definition
(RefSeq) solute carrier family 12 member 8 isoform X2
  KO
K14428  solute carrier family 12 (potassium/chloride transporters), member 8
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Brite
KEGG Orthology (KO) [BR:oro00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:oro02000]
    101375792 (SLC12A8)
Transporters [BR:oro02000]
 Solute carrier family (SLC)
  SLC12: Electroneutral cation-coupled Cl cotransporter
   101375792 (SLC12A8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_permease
Motif
Other DBs
NCBI-GeneID: 101375792
NCBI-ProteinID: XP_004391973
UniProt: A0A2U3VBS2
LinkDB All DBs
Position
Unknown
AA seq 712 aa AA seqDB search
MAQMSQVQELFHEAAQQGALAQRQPWWKSQLFVREPVLFGTWDGVFTSCMINIFGVVLFL
RTGWLVGNTGVLLGMFLVSFVVLVALITVMSGIGVGEHCGVGSGGVYAMISSVLGGQTGG
TIGLLYVFGQCVAGAMYITGFAESISDLLSLRSIWAVRGISVVVLLALLGINLAGVKWMI
RLQLLLLLLLAVSTLDFVVGSFTHLDPELGFVGYSPELLRNNTLPDYSPGESFFTVFGVF
FPAATGVMAGFNMGGDLREPAASIPLGSLAAVGISWFLYLVFVFLLGAACTREALRYDFL
IAEKVSLVGFLFLLGLYISSLASCMGGLYGAPRILQCIAQEKVIPALACLGQGKGPNKTP
VAAIFLTSLVTMAFVLVGQVNVLAPIVTINFMLTYIAVDYSYFSLSMVPCSLPRVPELVP
KEGTGALCCSEHLLLEKAPSYGSEGMAQSLPEGTLLEFTKDMDQLLQLTRKLETSQLRQG
GSDGIPESKKGNRKKATKQTLQDSFLLDLKSPASFPAEGSDRLPTASWEGQEAYWNKQSA
RSEGALPGGPCPELVPEPSNQPAPTGEDFFLKSTLQEQDIQRPTSFYTHMCNPWVSLLGA
FGSLLIMFVIQWVYTLINMGVAAVVYFYIGRASPGLHLGLASSFSFFRWMKSLLIPSCRS
LRSPQEQIILAPSLARVDMEMTQLTQENADFATRDRYHHSSLLSREQLMSQY
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atggcccagatgtctcaagtgcaggaactcttccatgaggcagcccagcagggggcgctg
gcccagcgccagccctggtggaagagccagctgttcgtccgggagccagtgctgtttggg
acctgggatggtgtgttcacgtcttgcatgatcaacatttttggggttgtccttttcctg
aggactggctggctggtgggaaacacaggagtgctcctgggcatgtttctggtatccttc
gttgtcctagtggccctcatcactgtgatgtctggcattggtgttggggagcattgtggt
gttggcagcgggggtgtctacgcgatgatatcctcggtcctcggcgggcagaccggaggc
acgatcgggctgctgtacgtgttcggacagtgtgtcgcaggtgccatgtacatcaccggc
tttgctgagtccatctctgatttgctgagcctcaggagtatctgggcagtgcgaggaatt
tcagtcgtggtgcttctggccttgctggggattaacctagcaggtgtcaaatggatgatc
cgcctccagctgctgctgctgctcctgctggctgtgtccacactggacttcgtggtgggc
tctttcacgcatctggacccagagctcggttttgtgggctattcaccagaactgctacgg
aacaacactctgccagattacagccccggggaatcttttttcactgtctttggggtattc
ttcccggcggctacaggagtcatggccggtttcaacatggggggtgacctccgggagccc
gctgccagcatccccctgggctccctagcagctgttggcatctcgtggtttctgtacctc
gtattcgtcttcctgctgggcgctgcctgcacccgagaggcccttcgctatgacttcctg
atagcagaaaaggtgtccctggtaggcttcctgttccttttgggcttatacatttcatcc
ctggcctcctgtatgggaggactctacggagctccccggatcctgcagtgcattgcccag
gagaaagtcattcctgcgctggcctgtttggggcaagggaaagggccaaataaaacacct
gtagctgccatcttcctgaccagcttagtgaccatggcctttgtccttgtgggccaggtg
aatgtgttagcccccatcgtcaccatcaatttcatgctgacgtatattgcagtggactac
tcctacttctccctgtccatggttccctgcagccttccccgggtgcctgagttagtgccc
aaggagggcacaggagctctctgctgctctgagcacctgctcttggagaaggctcccagc
tatggctctgagggcatggcccaaagcctccctgagggcactctgctagaattcaccaaa
gacatggatcagctcctccagctaaccaggaaacttgagactagccagctgaggcaagga
ggcagtgacgggatcccagaaagtaagaaggggaaccgcaagaaggccaccaagcaaacc
ctacaagatagcttccttttggacctcaagtccccagcttccttccctgctgagggctct
gacagattgcctactgcctcttgggagggacaggaggcctactggaacaagcagagtgcc
aggagtgaaggggctctgcctggaggaccatgtcctgaacttgtccctgagccgagcaac
cagcctgccccaactggagaagatttcttcctaaagtctacgctccaagaacaagatatc
cagagaccaacttctttctacacccacatgtgcaacccctgggtctccctgttaggggct
tttgggtctcttctcatcatgtttgtgatccagtgggtttacaccctcattaacatgggc
gttgctgctgttgtatatttctacattggtcgggccagtccagggcttcaccttggatta
gcctccagcttcagtttcttcaggtggatgaagtcccttctgatcccctcctgcaggagc
ttgagatctccccaagagcagataattttggcaccatccctggctagggttgacatggag
atgactcagctcacccaggagaacgcagacttcgccactcgggatcgctaccaccactcc
tcccttttgagtcgggaacagctgatgtctcagtactga

DBGET integrated database retrieval system