KEGG   Odobenus rosmarus divergens (Pacific walrus): 101375882
Entry
101375882         CDS       T05148                                 

Gene name
IFNGR1
Definition
(RefSeq) interferon gamma receptor 1
  KO
K05132  interferon gamma receptor 1
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04060  Cytokine-cytokine receptor interaction
oro04066  HIF-1 signaling pathway
oro04217  Necroptosis
oro04380  Osteoclast differentiation
oro04630  JAK-STAT signaling pathway
oro04650  Natural killer cell mediated cytotoxicity
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro05140  Leishmaniasis
oro05142  Chagas disease
oro05145  Toxoplasmosis
oro05152  Tuberculosis
oro05164  Influenza A
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05168  Herpes simplex virus 1 infection
oro05200  Pathways in cancer
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oro05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101375882 (IFNGR1)
   04066 HIF-1 signaling pathway
    101375882 (IFNGR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101375882 (IFNGR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101375882 (IFNGR1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101375882 (IFNGR1)
   04658 Th1 and Th2 cell differentiation
    101375882 (IFNGR1)
   04659 Th17 cell differentiation
    101375882 (IFNGR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101375882 (IFNGR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101375882 (IFNGR1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101375882 (IFNGR1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101375882 (IFNGR1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101375882 (IFNGR1)
  09172 Infectious disease: viral
   05164 Influenza A
    101375882 (IFNGR1)
   05168 Herpes simplex virus 1 infection
    101375882 (IFNGR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101375882 (IFNGR1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101375882 (IFNGR1)
   05140 Leishmaniasis
    101375882 (IFNGR1)
   05142 Chagas disease
    101375882 (IFNGR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:oro04050]
    101375882 (IFNGR1)
   04090 CD molecules [BR:oro04090]
    101375882 (IFNGR1)
Cytokine receptors [BR:oro04050]
 Interleukin receptor families
  IFN receptor family
   101375882 (IFNGR1)
CD molecules [BR:oro04090]
 Proteins
  101375882 (IFNGR1)
SSDB
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 101375882
NCBI-ProteinID: XP_004410313
UniProt: A0A2U3WMR5
LinkDB
Position
Unknown
AA seq 466 aa
MALQLLLLLVLQAGSWAEMSLADLELSSVPIPTNIKIEAYNFNTVLLWDYPTMPQTPVFT
VQVKNYGEAIWIDACNTSHHYCNIFSVINDPSLSLWARIKARLGQKESAYAESKEFILCK
QGNIGPPAVGIRKMENQIIIDIFHPLTNISGREPVPIYDENNCHIFMYTVDLRINGSKTT
YKMKVENENDCSETQCHLVVPVSSLNSDYCVSAQGESKDWLVKTEMSKELCITTSDDNHM
EDPVWIPIVAVLLLFLVLILVFVYCYTKKMNPFKRESIMLPKSLLSVVKNASSETKSESK
CISPITYQPIAPENEKMIWEEHLSPATLGTPTEDNLGKTEHREDVSSEIEVVTTEKNTSD
VAPGSPLTPGMRENSVHPNSNQSEPCVVTLNSYHSRNGSDSGVVESDSFLSDSEFSPNNK
TELKTEGQECVVLRNTTTSFGYDKPHVLVDLLVDEGGKESLIGYID
NT seq 1401 nt   +upstreamnt  +downstreamnt
atggctctgcaacttttgctcctcctcgtcttgcaggccgggagctgggctgagatgagc
ctcgcggatctggagctgtcttcggtgccgataccaaccaatattaaaattgaggcctat
aactttaatactgtcctattgtgggactacccaaccatgccacagacccctgtttttact
gtacaggtaaagaactatggggaagcaatatggattgatgcctgcaatacctctcatcat
tattgtaatatcttttccgtaattaatgatccatcactttctctctgggcgagaattaaa
gctaggcttggacaaaaagaatcagcctatgcagagtcaaaagaatttattttatgtaaa
caagggaacattggaccacctgcagtgggtatcagaaagatggaaaaccaaatcatcatt
gacatatttcaccctttaactaatataagtggaagagagccagtacccatctatgatgaa
aataattgtcacatattcatgtacacagtggatttgagaataaatggaagtaagaccacg
tataaaatgaaagtagagaatgaaaatgattgcagtgagactcagtgccatctcgtggtc
cccgtgtcctcgctgaattctgactactgtgtttcagcccaaggcgagtccaaagattgg
cttgttaaaactgagatgtccaaagaactttgtatcaccacttctgatgataaccacatg
gaagatcctgtttggattccaattgttgccgttctcctactttttctagtacttatcctg
gtatttgtatattgttacactaagaagatgaatccgtttaagagggagagcatcatgtta
cccaagtccttgctgtctgtggtaaaaaatgcctcttcagagacaaaatctgaatcaaaa
tgtatatcacccatcacctaccaaccgattgccccagaaaatgagaagatgatctgggaa
gagcacttgtccccagcaacgcttggtacgcccactgaagacaacctaggaaaaacggaa
caccgagaagacgtttccagtgaaatagaagtggtgaccactgaaaaaaatacttctgac
gtggctcctggtagccctctgaccccaggaatgagagagaattctgtccatccaaatagt
aaccagtctgaaccctgtgtcgtcaccttaaactcctatcactccagaaatggttctgat
agtggcgttgtggaatccgacagcttcttatctgactcagaattttccccaaataataaa
actgaactaaagaccgaaggacaggagtgcgtagtgctgagaaacactaccacctccttt
ggttacgacaagccgcatgtgttagtggatctgcttgtggacgaaggtggtaaggaatcc
ttgattggttatatagactga

DBGET integrated database retrieval system