KEGG   Odobenus rosmarus divergens (Pacific walrus): 101377143
Entry
101377143         CDS       T05148                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01522  Endocrine resistance
oro04010  MAPK signaling pathway
oro04015  Rap1 signaling pathway
oro04068  FoxO signaling pathway
oro04071  Sphingolipid signaling pathway
oro04114  Oocyte meiosis
oro04218  Cellular senescence
oro04261  Adrenergic signaling in cardiomyocytes
oro04370  VEGF signaling pathway
oro04380  Osteoclast differentiation
oro04550  Signaling pathways regulating pluripotency of stem cells
oro04611  Platelet activation
oro04613  Neutrophil extracellular trap formation
oro04620  Toll-like receptor signaling pathway
oro04621  NOD-like receptor signaling pathway
oro04622  RIG-I-like receptor signaling pathway
oro04625  C-type lectin receptor signaling pathway
oro04657  IL-17 signaling pathway
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro04664  Fc epsilon RI signaling pathway
oro04668  TNF signaling pathway
oro04670  Leukocyte transendothelial migration
oro04714  Thermogenesis
oro04722  Neurotrophin signaling pathway
oro04723  Retrograde endocannabinoid signaling
oro04728  Dopaminergic synapse
oro04750  Inflammatory mediator regulation of TRP channels
oro04912  GnRH signaling pathway
oro04914  Progesterone-mediated oocyte maturation
oro04917  Prolactin signaling pathway
oro04926  Relaxin signaling pathway
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro04935  Growth hormone synthesis, secretion and action
oro05014  Amyotrophic lateral sclerosis
oro05020  Prion disease
oro05022  Pathways of neurodegeneration - multiple diseases
oro05132  Salmonella infection
oro05133  Pertussis
oro05135  Yersinia infection
oro05140  Leishmaniasis
oro05142  Chagas disease
oro05145  Toxoplasmosis
oro05152  Tuberculosis
oro05161  Hepatitis B
oro05163  Human cytomegalovirus infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05169  Epstein-Barr virus infection
oro05170  Human immunodeficiency virus 1 infection
oro05171  Coronavirus disease - COVID-19
oro05205  Proteoglycans in cancer
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101377143 (MAPK13)
   04015 Rap1 signaling pathway
    101377143 (MAPK13)
   04370 VEGF signaling pathway
    101377143 (MAPK13)
   04668 TNF signaling pathway
    101377143 (MAPK13)
   04068 FoxO signaling pathway
    101377143 (MAPK13)
   04071 Sphingolipid signaling pathway
    101377143 (MAPK13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101377143 (MAPK13)
   04218 Cellular senescence
    101377143 (MAPK13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101377143 (MAPK13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101377143 (MAPK13)
   04613 Neutrophil extracellular trap formation
    101377143 (MAPK13)
   04620 Toll-like receptor signaling pathway
    101377143 (MAPK13)
   04621 NOD-like receptor signaling pathway
    101377143 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    101377143 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    101377143 (MAPK13)
   04660 T cell receptor signaling pathway
    101377143 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    101377143 (MAPK13)
   04659 Th17 cell differentiation
    101377143 (MAPK13)
   04657 IL-17 signaling pathway
    101377143 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    101377143 (MAPK13)
   04670 Leukocyte transendothelial migration
    101377143 (MAPK13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101377143 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    101377143 (MAPK13)
   04917 Prolactin signaling pathway
    101377143 (MAPK13)
   04926 Relaxin signaling pathway
    101377143 (MAPK13)
   04935 Growth hormone synthesis, secretion and action
    101377143 (MAPK13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101377143 (MAPK13)
  09156 Nervous system
   04728 Dopaminergic synapse
    101377143 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    101377143 (MAPK13)
   04722 Neurotrophin signaling pathway
    101377143 (MAPK13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101377143 (MAPK13)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101377143 (MAPK13)
  09159 Environmental adaptation
   04714 Thermogenesis
    101377143 (MAPK13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101377143 (MAPK13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101377143 (MAPK13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101377143 (MAPK13)
   05020 Prion disease
    101377143 (MAPK13)
   05022 Pathways of neurodegeneration - multiple diseases
    101377143 (MAPK13)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101377143 (MAPK13)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101377143 (MAPK13)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101377143 (MAPK13)
   05135 Yersinia infection
    101377143 (MAPK13)
   05133 Pertussis
    101377143 (MAPK13)
   05152 Tuberculosis
    101377143 (MAPK13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101377143 (MAPK13)
   05161 Hepatitis B
    101377143 (MAPK13)
   05171 Coronavirus disease - COVID-19
    101377143 (MAPK13)
   05163 Human cytomegalovirus infection
    101377143 (MAPK13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101377143 (MAPK13)
   05169 Epstein-Barr virus infection
    101377143 (MAPK13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101377143 (MAPK13)
   05140 Leishmaniasis
    101377143 (MAPK13)
   05142 Chagas disease
    101377143 (MAPK13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101377143 (MAPK13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oro01001]
    101377143 (MAPK13)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101377143 (MAPK13)
Protein kinases [BR:oro01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101377143 (MAPK13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like DUF4023
Other DBs
NCBI-GeneID: 101377143
NCBI-ProteinID: XP_004409851
UniProt: A0A2U3WLM2
LinkDB
Position
Unknown
AA seq 366 aa
MSFTRKRGFYKQDVNRTAWELPKTYVSPTHVGSGAYGAVCSAIDKRSGEKVAIKKLSRPF
QSEIFARRAYRELRLLKHMQHENVIGLLDVFTSASSLRSFHDFYLVMPFMQTDLQKIMGM
EFSEDKIQYLVYQILKGLKYIHSAGVIHRDLKPGNLAVNEDCELKILDFGLARHADAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLSQILKVTG
VPGAEFVQKLNDKAAKSYIQALPQSPKKDFSQLFPRASPQAIDLLEKMLELDVDKRLTAS
QALAHPFFEPFRDPEEETEAPQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRR
SGMKLQ
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgagcttcacccggaaaaggggcttctacaagcaggacgtcaacaggaccgcctgggag
ctgcccaagacctacgtgtccccgacgcacgtaggcagcggggcctatggcgccgtgtgc
tccgccatcgacaagcggtcaggggagaaggtggccatcaagaagctgagccggcccttc
cagtccgagatctttgccaggcgggcgtaccgagagctgcggctgctgaagcacatgcag
catgagaacgtcatcgggctcctggatgtcttcacctcagcctcctccctgcgcagcttc
catgacttctacctggtgatgcccttcatgcagacggacctgcagaagatcatggggatg
gagttcagtgaggacaagatccagtacctggtgtatcagatactcaagggtctcaagtac
atccactcagctggggtcatccacagggacctgaagccgggcaacctggccgtgaacgag
gactgtgagctgaagatcttggatttcgggctggcccggcatgcagatgccgagatgaca
ggctatgtggtgacccgctggtaccgggcccccgaggtgatcctcagctggatgcactac
aaccagactgtggacatctggtctgtgggctgtatcatggcggagatgctgacggggaag
actctgttcaaggggaaagattacctggaccagctgtcccagatcctaaaagtgaccggg
gtgccgggcgcagagtttgtgcagaagttgaacgacaaagcggccaaatcctacatccag
gccctgccacagagccccaagaaggatttctctcagctcttcccgcgcgccagcccccag
gccatagacctgctggagaagatgctggagctggacgttgacaagcgcctgacggcctcg
caggccctcgcccaccccttctttgagcccttccgagaccctgaggaggagacagaggcc
ccgcagccctttgatgattccttagaacatgagaaactcacagtggatgaatggaagcag
cacatctacaaggagattgtgaacttcagccccattgcccggaaggactcacggcgccgg
agcggcatgaagctgcagtga

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101377430
Entry
101377430         CDS       T05148                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01522  Endocrine resistance
oro04010  MAPK signaling pathway
oro04015  Rap1 signaling pathway
oro04068  FoxO signaling pathway
oro04071  Sphingolipid signaling pathway
oro04114  Oocyte meiosis
oro04218  Cellular senescence
oro04261  Adrenergic signaling in cardiomyocytes
oro04370  VEGF signaling pathway
oro04380  Osteoclast differentiation
oro04550  Signaling pathways regulating pluripotency of stem cells
oro04611  Platelet activation
oro04613  Neutrophil extracellular trap formation
oro04620  Toll-like receptor signaling pathway
oro04621  NOD-like receptor signaling pathway
oro04622  RIG-I-like receptor signaling pathway
oro04625  C-type lectin receptor signaling pathway
oro04657  IL-17 signaling pathway
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro04664  Fc epsilon RI signaling pathway
oro04668  TNF signaling pathway
oro04670  Leukocyte transendothelial migration
oro04714  Thermogenesis
oro04722  Neurotrophin signaling pathway
oro04723  Retrograde endocannabinoid signaling
oro04728  Dopaminergic synapse
oro04750  Inflammatory mediator regulation of TRP channels
oro04912  GnRH signaling pathway
oro04914  Progesterone-mediated oocyte maturation
oro04917  Prolactin signaling pathway
oro04926  Relaxin signaling pathway
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro04935  Growth hormone synthesis, secretion and action
oro05014  Amyotrophic lateral sclerosis
oro05020  Prion disease
oro05022  Pathways of neurodegeneration - multiple diseases
oro05132  Salmonella infection
oro05133  Pertussis
oro05135  Yersinia infection
oro05140  Leishmaniasis
oro05142  Chagas disease
oro05145  Toxoplasmosis
oro05152  Tuberculosis
oro05161  Hepatitis B
oro05163  Human cytomegalovirus infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05169  Epstein-Barr virus infection
oro05170  Human immunodeficiency virus 1 infection
oro05171  Coronavirus disease - COVID-19
oro05205  Proteoglycans in cancer
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101377430 (MAPK14)
   04015 Rap1 signaling pathway
    101377430 (MAPK14)
   04370 VEGF signaling pathway
    101377430 (MAPK14)
   04668 TNF signaling pathway
    101377430 (MAPK14)
   04068 FoxO signaling pathway
    101377430 (MAPK14)
   04071 Sphingolipid signaling pathway
    101377430 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101377430 (MAPK14)
   04218 Cellular senescence
    101377430 (MAPK14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101377430 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101377430 (MAPK14)
   04613 Neutrophil extracellular trap formation
    101377430 (MAPK14)
   04620 Toll-like receptor signaling pathway
    101377430 (MAPK14)
   04621 NOD-like receptor signaling pathway
    101377430 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    101377430 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    101377430 (MAPK14)
   04660 T cell receptor signaling pathway
    101377430 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    101377430 (MAPK14)
   04659 Th17 cell differentiation
    101377430 (MAPK14)
   04657 IL-17 signaling pathway
    101377430 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    101377430 (MAPK14)
   04670 Leukocyte transendothelial migration
    101377430 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101377430 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    101377430 (MAPK14)
   04917 Prolactin signaling pathway
    101377430 (MAPK14)
   04926 Relaxin signaling pathway
    101377430 (MAPK14)
   04935 Growth hormone synthesis, secretion and action
    101377430 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101377430 (MAPK14)
  09156 Nervous system
   04728 Dopaminergic synapse
    101377430 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    101377430 (MAPK14)
   04722 Neurotrophin signaling pathway
    101377430 (MAPK14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101377430 (MAPK14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101377430 (MAPK14)
  09159 Environmental adaptation
   04714 Thermogenesis
    101377430 (MAPK14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101377430 (MAPK14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101377430 (MAPK14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101377430 (MAPK14)
   05020 Prion disease
    101377430 (MAPK14)
   05022 Pathways of neurodegeneration - multiple diseases
    101377430 (MAPK14)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101377430 (MAPK14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101377430 (MAPK14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101377430 (MAPK14)
   05135 Yersinia infection
    101377430 (MAPK14)
   05133 Pertussis
    101377430 (MAPK14)
   05152 Tuberculosis
    101377430 (MAPK14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101377430 (MAPK14)
   05161 Hepatitis B
    101377430 (MAPK14)
   05171 Coronavirus disease - COVID-19
    101377430 (MAPK14)
   05163 Human cytomegalovirus infection
    101377430 (MAPK14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101377430 (MAPK14)
   05169 Epstein-Barr virus infection
    101377430 (MAPK14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101377430 (MAPK14)
   05140 Leishmaniasis
    101377430 (MAPK14)
   05142 Chagas disease
    101377430 (MAPK14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101377430 (MAPK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oro01001]
    101377430 (MAPK14)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101377430 (MAPK14)
Protein kinases [BR:oro01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101377430 (MAPK14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH NAD_binding_8 Kinase-like
Other DBs
NCBI-GeneID: 101377430
NCBI-ProteinID: XP_004409852
UniProt: A0A2U3WLM5
LinkDB
Position
Unknown
AA seq 360 aa
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGADLLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagacaatctgggaggtg
cccgagcgttaccagaatctgtccccggtgggctccggtgcctatggctccgtgtgtgct
gcttttgacacaaaaaccgggttacgtgtggcagtgaagaagctctccagaccatttcag
tccattattcatgccaaaaggacctacagagaactgcggttacttaaacatatgaaacat
gaaaatgtgattggtctgttggatgtttttacacctgcaaggtctctggaggaattcaat
gatgtgtatctggtcacccatctcatgggagcagatctgaacaacattgtgaaatgtcag
aagcttacggatgaccatgttcagttcctcatctaccagattctccgaggtctcaagtat
atacattcagctgacataattcacagggacctaaaacctagtaatctagcagtgaatgaa
gactgtgagctgaagatcttggattttggactggcccgacatacagatgatgaaatgaca
ggctatgtggccaccaggtggtaccgggctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggctgagctgttgactggaaga
acgttgtttcctggtacagaccatattgatcagttgaagctcattttaagactcgttgga
accccaggggctgatcttttgaagaaaatctcctcagagtctgcaagaaactacattcag
tctttgacccagatgccgaaaatgaactttgcaaatgtatttattggcgccaatcccttg
gctgtcgacttgctggagaagatgcttgtattggactcagacaagagaattacggcagcc
caagccctcgcacatgcctattttgctcagtaccatgatcctgatgatgaaccagtggct
gatccttacgatcagtcctttgaaagcagggacctccttatagatgaatggaaaagcctg
acctacgatgaagtcatcagctttgtgccaccaccccttgaccaagaagagatggaatcc
tga

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101382259
Entry
101382259         CDS       T05148                                 

Gene name
MAPK11
Definition
(RefSeq) mitogen-activated protein kinase 11 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01522  Endocrine resistance
oro04010  MAPK signaling pathway
oro04015  Rap1 signaling pathway
oro04068  FoxO signaling pathway
oro04071  Sphingolipid signaling pathway
oro04114  Oocyte meiosis
oro04218  Cellular senescence
oro04261  Adrenergic signaling in cardiomyocytes
oro04370  VEGF signaling pathway
oro04380  Osteoclast differentiation
oro04550  Signaling pathways regulating pluripotency of stem cells
oro04611  Platelet activation
oro04613  Neutrophil extracellular trap formation
oro04620  Toll-like receptor signaling pathway
oro04621  NOD-like receptor signaling pathway
oro04622  RIG-I-like receptor signaling pathway
oro04625  C-type lectin receptor signaling pathway
oro04657  IL-17 signaling pathway
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro04664  Fc epsilon RI signaling pathway
oro04668  TNF signaling pathway
oro04670  Leukocyte transendothelial migration
oro04714  Thermogenesis
oro04722  Neurotrophin signaling pathway
oro04723  Retrograde endocannabinoid signaling
oro04728  Dopaminergic synapse
oro04750  Inflammatory mediator regulation of TRP channels
oro04912  GnRH signaling pathway
oro04914  Progesterone-mediated oocyte maturation
oro04917  Prolactin signaling pathway
oro04926  Relaxin signaling pathway
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro04935  Growth hormone synthesis, secretion and action
oro05014  Amyotrophic lateral sclerosis
oro05020  Prion disease
oro05022  Pathways of neurodegeneration - multiple diseases
oro05132  Salmonella infection
oro05133  Pertussis
oro05135  Yersinia infection
oro05140  Leishmaniasis
oro05142  Chagas disease
oro05145  Toxoplasmosis
oro05152  Tuberculosis
oro05161  Hepatitis B
oro05163  Human cytomegalovirus infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05169  Epstein-Barr virus infection
oro05170  Human immunodeficiency virus 1 infection
oro05171  Coronavirus disease - COVID-19
oro05205  Proteoglycans in cancer
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101382259 (MAPK11)
   04015 Rap1 signaling pathway
    101382259 (MAPK11)
   04370 VEGF signaling pathway
    101382259 (MAPK11)
   04668 TNF signaling pathway
    101382259 (MAPK11)
   04068 FoxO signaling pathway
    101382259 (MAPK11)
   04071 Sphingolipid signaling pathway
    101382259 (MAPK11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101382259 (MAPK11)
   04218 Cellular senescence
    101382259 (MAPK11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101382259 (MAPK11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101382259 (MAPK11)
   04613 Neutrophil extracellular trap formation
    101382259 (MAPK11)
   04620 Toll-like receptor signaling pathway
    101382259 (MAPK11)
   04621 NOD-like receptor signaling pathway
    101382259 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    101382259 (MAPK11)
   04625 C-type lectin receptor signaling pathway
    101382259 (MAPK11)
   04660 T cell receptor signaling pathway
    101382259 (MAPK11)
   04658 Th1 and Th2 cell differentiation
    101382259 (MAPK11)
   04659 Th17 cell differentiation
    101382259 (MAPK11)
   04657 IL-17 signaling pathway
    101382259 (MAPK11)
   04664 Fc epsilon RI signaling pathway
    101382259 (MAPK11)
   04670 Leukocyte transendothelial migration
    101382259 (MAPK11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101382259 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    101382259 (MAPK11)
   04917 Prolactin signaling pathway
    101382259 (MAPK11)
   04926 Relaxin signaling pathway
    101382259 (MAPK11)
   04935 Growth hormone synthesis, secretion and action
    101382259 (MAPK11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101382259 (MAPK11)
  09156 Nervous system
   04728 Dopaminergic synapse
    101382259 (MAPK11)
   04723 Retrograde endocannabinoid signaling
    101382259 (MAPK11)
   04722 Neurotrophin signaling pathway
    101382259 (MAPK11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101382259 (MAPK11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101382259 (MAPK11)
  09159 Environmental adaptation
   04714 Thermogenesis
    101382259 (MAPK11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101382259 (MAPK11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101382259 (MAPK11)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101382259 (MAPK11)
   05020 Prion disease
    101382259 (MAPK11)
   05022 Pathways of neurodegeneration - multiple diseases
    101382259 (MAPK11)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101382259 (MAPK11)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101382259 (MAPK11)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101382259 (MAPK11)
   05135 Yersinia infection
    101382259 (MAPK11)
   05133 Pertussis
    101382259 (MAPK11)
   05152 Tuberculosis
    101382259 (MAPK11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101382259 (MAPK11)
   05161 Hepatitis B
    101382259 (MAPK11)
   05171 Coronavirus disease - COVID-19
    101382259 (MAPK11)
   05163 Human cytomegalovirus infection
    101382259 (MAPK11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101382259 (MAPK11)
   05169 Epstein-Barr virus infection
    101382259 (MAPK11)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101382259 (MAPK11)
   05140 Leishmaniasis
    101382259 (MAPK11)
   05142 Chagas disease
    101382259 (MAPK11)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101382259 (MAPK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oro01001]
    101382259 (MAPK11)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101382259 (MAPK11)
Protein kinases [BR:oro01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101382259 (MAPK11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Cas_CT1975 Kinase-like
Other DBs
NCBI-GeneID: 101382259
NCBI-ProteinID: XP_004409720
UniProt: A0A2U3WLA9
LinkDB
Position
Unknown
AA seq 364 aa
MSGPRAGFYRLELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGNDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLRSIFHGANPLAVDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPDDEPEAEPYDESVEAKERTVEEWKELTYQEVLSFKPAEPPQSPGSL
EIEQ
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgtcgggcccgcgcgcaggcttctaccggctggagctcaacaagacggtgtgggaggtg
ccgcagcggctgcaggggctgcgcccggtgggctccggcgcctacggctcggtctgctca
gcctatgacgcgcggctgcgccagaaggtggcggtgaagaagctgtcgcgacccttccag
tctctgatccacgcgcggagaacttaccgcgagctgcggctgctcaagcacttgaagcac
gagaacgtcatcgggttgctggacgtgttcacgccggccacctccattgaggacttcagc
gaagtgtacctggtgaccaccctgatgggcgcagacctgaacaacatcgtcaagtgccag
gcgctgagcgacgagcacgtccagttcctggtttaccagttgctgcgcgggcttaagtac
atccactctgcggggatcatccaccgggacctgaagcccagcaacgtggctgtgaacgag
gactgcgagcttaggatcctggactttgggctagcccgccaggctgatgaagagatgact
ggctatgtggccactcgctggtaccgtgcacctgagatcatgctcaactggatgcactac
aaccagacagtggacatctggtctgtgggctgcatcatggctgagctgctccagggaaag
gctctctttccaggaaatgactacatcgaccagctgaagcgaatcatggaggtggtgggc
acacccagccctgaggttctagcaaagatatcctcagaacacgcccggacatacatccag
tccctgccccccatgccccagaaggacctcaggagcatcttccatggagccaaccccctg
gctgtggacctgctgggaaggatgctggtgctcgacagtgaccagagggtcagtgcggcc
gaggccctggcccatgcctacttcagccagtaccatgaccctgacgatgagcctgaggcc
gagccctatgatgagagcgttgaggccaaggagcgcacagtggaggagtggaaggagctc
acctaccaggaggtcctcagcttcaagcctgcagagccaccgcagtctcccggcagcctg
gagattgagcagtga

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101382558
Entry
101382558         CDS       T05148                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01522  Endocrine resistance
oro04010  MAPK signaling pathway
oro04015  Rap1 signaling pathway
oro04068  FoxO signaling pathway
oro04071  Sphingolipid signaling pathway
oro04114  Oocyte meiosis
oro04218  Cellular senescence
oro04261  Adrenergic signaling in cardiomyocytes
oro04370  VEGF signaling pathway
oro04380  Osteoclast differentiation
oro04550  Signaling pathways regulating pluripotency of stem cells
oro04611  Platelet activation
oro04613  Neutrophil extracellular trap formation
oro04620  Toll-like receptor signaling pathway
oro04621  NOD-like receptor signaling pathway
oro04622  RIG-I-like receptor signaling pathway
oro04625  C-type lectin receptor signaling pathway
oro04657  IL-17 signaling pathway
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro04664  Fc epsilon RI signaling pathway
oro04668  TNF signaling pathway
oro04670  Leukocyte transendothelial migration
oro04714  Thermogenesis
oro04722  Neurotrophin signaling pathway
oro04723  Retrograde endocannabinoid signaling
oro04728  Dopaminergic synapse
oro04750  Inflammatory mediator regulation of TRP channels
oro04912  GnRH signaling pathway
oro04914  Progesterone-mediated oocyte maturation
oro04917  Prolactin signaling pathway
oro04926  Relaxin signaling pathway
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro04935  Growth hormone synthesis, secretion and action
oro05014  Amyotrophic lateral sclerosis
oro05020  Prion disease
oro05022  Pathways of neurodegeneration - multiple diseases
oro05132  Salmonella infection
oro05133  Pertussis
oro05135  Yersinia infection
oro05140  Leishmaniasis
oro05142  Chagas disease
oro05145  Toxoplasmosis
oro05152  Tuberculosis
oro05161  Hepatitis B
oro05163  Human cytomegalovirus infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05169  Epstein-Barr virus infection
oro05170  Human immunodeficiency virus 1 infection
oro05171  Coronavirus disease - COVID-19
oro05205  Proteoglycans in cancer
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101382558 (MAPK12)
   04015 Rap1 signaling pathway
    101382558 (MAPK12)
   04370 VEGF signaling pathway
    101382558 (MAPK12)
   04668 TNF signaling pathway
    101382558 (MAPK12)
   04068 FoxO signaling pathway
    101382558 (MAPK12)
   04071 Sphingolipid signaling pathway
    101382558 (MAPK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101382558 (MAPK12)
   04218 Cellular senescence
    101382558 (MAPK12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101382558 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101382558 (MAPK12)
   04613 Neutrophil extracellular trap formation
    101382558 (MAPK12)
   04620 Toll-like receptor signaling pathway
    101382558 (MAPK12)
   04621 NOD-like receptor signaling pathway
    101382558 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    101382558 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    101382558 (MAPK12)
   04660 T cell receptor signaling pathway
    101382558 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    101382558 (MAPK12)
   04659 Th17 cell differentiation
    101382558 (MAPK12)
   04657 IL-17 signaling pathway
    101382558 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    101382558 (MAPK12)
   04670 Leukocyte transendothelial migration
    101382558 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101382558 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    101382558 (MAPK12)
   04917 Prolactin signaling pathway
    101382558 (MAPK12)
   04926 Relaxin signaling pathway
    101382558 (MAPK12)
   04935 Growth hormone synthesis, secretion and action
    101382558 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101382558 (MAPK12)
  09156 Nervous system
   04728 Dopaminergic synapse
    101382558 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    101382558 (MAPK12)
   04722 Neurotrophin signaling pathway
    101382558 (MAPK12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101382558 (MAPK12)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101382558 (MAPK12)
  09159 Environmental adaptation
   04714 Thermogenesis
    101382558 (MAPK12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101382558 (MAPK12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101382558 (MAPK12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101382558 (MAPK12)
   05020 Prion disease
    101382558 (MAPK12)
   05022 Pathways of neurodegeneration - multiple diseases
    101382558 (MAPK12)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101382558 (MAPK12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101382558 (MAPK12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101382558 (MAPK12)
   05135 Yersinia infection
    101382558 (MAPK12)
   05133 Pertussis
    101382558 (MAPK12)
   05152 Tuberculosis
    101382558 (MAPK12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101382558 (MAPK12)
   05161 Hepatitis B
    101382558 (MAPK12)
   05171 Coronavirus disease - COVID-19
    101382558 (MAPK12)
   05163 Human cytomegalovirus infection
    101382558 (MAPK12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101382558 (MAPK12)
   05169 Epstein-Barr virus infection
    101382558 (MAPK12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101382558 (MAPK12)
   05140 Leishmaniasis
    101382558 (MAPK12)
   05142 Chagas disease
    101382558 (MAPK12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101382558 (MAPK12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oro01001]
    101382558 (MAPK12)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101382558 (MAPK12)
Protein kinases [BR:oro01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101382558 (MAPK12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 101382558
NCBI-ProteinID: XP_004409721
UniProt: A0A2U3WLB3
LinkDB
Position
Unknown
AA seq 367 aa
MSSPPPARRGFYRQEVTKTAWEVRAVYQDLQPVGSGAYGAVCSAVDSRTGAKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHEKLSEDRIQFLVYQMLKGLKYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSAGCIMAEMITGKTLFKGSDHLDQLKEIMK
VTGTPPAEFVQRLQSADAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAERRV
TAAEALTHPYFESLQDTEDEPKAQKYDESFDDMDRTLDEWKRVTYKEVLSFKPPRQLGTK
VSKETAL
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgagctctccaccacccgcccgcaggggcttttaccgccaggaggtgaccaagacggct
tgggaggtgcgcgccgtgtaccaggacctgcagcccgtgggctccggcgcctacggcgcg
gtgtgctcggccgtggacagccgcactggcgccaaggtggccatcaagaaactgtaccgg
cccttccagtcggagctcttcgccaagcgcgcctaccgcgaactgcgcctcctcaagcac
atgcgccacgagaacgtcatcgggctgctggacgtgttcacccctgatgaaaccctggat
gatttcacagacttttacctggtgatgccgttcatggggactgacctgggcaagctcatg
aagcacgagaagctgagtgaggaccgaatccagttccttgtctaccagatgctgaagggg
ctaaagtacatccatgctgctggcatcatccatagggacctgaagcccggcaatctggca
gtgaatgaggactgtgagctgaagatcctggacttcggcctggcgaggcaggcagacagc
gagatgactgggtatgtggtgactcggtggtaccgggcacctgaggtcatcttgaattgg
atgcgctacacacagacagtggatatctggtcggcgggctgcatcatggcggagatgatt
acagggaagacgctgttcaagggcagtgaccacctggaccagctgaaggagatcatgaag
gtgacagggacgcctcccgctgagtttgtgcagaggctgcagagtgccgatgcgaagaac
tacatgaagggcctccccgagttggagaagaaggatttcgcatccatcctgactaatgca
agtcctctggctgtgaacctcctggagaaaatgcttgtgctagatgcagagcggcgggtg
actgcggccgaggcgctgacccacccctacttcgagtcactgcaggacacggaggatgaa
cccaaggcccagaagtacgacgagtcctttgatgatatggaccgcacgctggatgagtgg
aaacgtgtcacatataaagaagtgctcagcttcaagcctccccggcagctggggaccaag
gtctccaaggagacggccctgtga

DBGET integrated database retrieval system